KEGG   Burkholderia vietnamiensis G4: Bcep1808_6309Help
Entry
Bcep1808_6309     CDS       T00493                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00010  Glycolysis / Gluconeogenesis
bvi00030  Pentose phosphate pathway
bvi00051  Fructose and mannose metabolism
bvi00052  Galactose metabolism
bvi00680  Methane metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
bvi01230  Biosynthesis of amino acids
Module
bvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_6309
   00030 Pentose phosphate pathway
    Bcep1808_6309
   00051 Fructose and mannose metabolism
    Bcep1808_6309
   00052 Galactose metabolism
    Bcep1808_6309
  Energy metabolism
   00680 Methane metabolism
    Bcep1808_6309
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bcep1808_6309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB STAS_2 Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABO59209
UniProt: A4JSF6
Position
3:complement(880188..881123)
Genome map
AA seq 311 aa AA seqDB search
MTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCIALYL
AGGPTGDVLTLLLEAERLPSVRIRIVGETRENVCVTETSTGREYRFLMPGPSVSDAEWRD
CAARLDAMQPAPRYLVLSGSLPPGAPDDLYATLARAAKARGSRVVVDASGRALGAALEEG
VHLVKPSIGELSALAGEALDDASACRVASELVARGQAEIVALTLGARGAWVVTRDRSLRL
PGRPAAVCSTVGAGDSFVGGMVWALARGVPLDDACRYALAASASSVEHPGTALCTRADVE
RIHDEIVALAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatcgttaccgttaccctgaacccggccgtcgacgtcgcgacgtcggtcgag
cacatcgtcgacacgcacaagctgcgatgcgcgcggccgcgccgcgacccgggcggcggc
ggcatcaacgtcgcgcggaccatccaccggctcggcggcgactgcatcgcgctgtacctg
gccggcggcccgaccggcgacgtgctgacgttgttgctcgaggccgagcgcctgccgagc
gtgcgcatccggatcgtcggcgagacgcgcgagaacgtctgcgtgaccgagacctcgacc
gggcgcgaataccgctttttgatgccggggccatcggtgagcgacgccgagtggcgcgac
tgcgcggcccgcctcgacgcgatgcagccggcgccgcgctatctcgtgctgagcggcagt
ctgccgcccggcgcgcccgacgatctgtacgcgacgctcgcacgggccgcgaaggcgcgg
ggcagtcgcgtcgtcgtcgacgcgtcgggccgtgcgctgggcgcggcgctggaggagggc
gttcatctcgtgaagcccagtatcggcgaactcagcgcgctggccggcgaagcgctcgac
gatgcgtccgcgtgccgagtggcgagcgaactcgtcgcgcgcggccaggccgagatcgtc
gcgttgacgctcggcgcgcgcggcgcgtgggtcgtcacgcgcgatcggtcgttgcgtctg
cccgggcggccggcagcggtatgcagcacggtcggcgccggcgacagtttcgtcggcggc
atggtgtgggcgctggcgcgcggcgtgccgctcgacgacgcgtgccgctatgcgctcgcc
gcatcggcttcgtcggtcgagcatccgggcaccgccctgtgcacgcgcgcggacgtcgag
cgcatccacgacgaaatcgttgcgctcgcaagctga

DBGET integrated database retrieval system