KEGG   Burkholderia vietnamiensis G4: Bcep1808_6429Help
Entry
Bcep1808_6429     CDS       T00493                                 

Definition
(GenBank) aminotransferase
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABO59326
UniProt: A4JSS3
Position
3:1020112..1021512
Genome map
AA seq 466 aa AA seqDB search
MNQAALIEADRQHLIHPVVNYRAHEARGVTVLESADGVFLRDGDGHTLLDAFSGLWCVNV
GYGRESIVKAAAEQMAKLPYATGYFHFGSQPAIELAERLAALAPPSLNRVYFTLGGSDAV
DSAVRFITHYFNATGRPSKKQMIALERGYHGSSSIGAGLTALPAFHRHFDLPRADQHHIP
SPYPYRHPLGDDPQALIAASVAALEAKVAALGADNVAAFFCEPIQGSGGVIVPPAGWLKA
MRDACRRLGILFVADEVITGFGRTGPLFACETESVEPDLMTVAKGLTAGYAPMGAVLMSD
EIYEGLAGSRTESAVVGHGHTYSAHPVSAAIGLEVLKLYHEGGLLANGRAQAPRFAAGLD
ALRAHPLVGDARSAGLLGALELVADKARKTRFDPALNVPDKIAAAAYANGVVFRAFGDGV
LGFAPALSFTAGEFDLMFERVRKTLDDVLADPGVQRALDAAHAQPA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagccgcgctgatcgaagccgatcgtcaacatctgatccatcccgtcgtcaac
tatcgtgcgcacgaagcgcgcggcgtcaccgtgctcgaatccgccgacggcgtgttcctg
cgcgatggcgacggccatacgctgctcgacgcgttctcgggcctgtggtgcgtgaacgtc
ggctacggccgcgagagcatcgtgaaggccgccgccgagcagatggcgaagctgccctac
gcgaccggctatttccatttcggctcgcagccggcgatcgaactcgccgaacggctcgcc
gcgctcgcgccgccgtcgctgaaccgcgtgtacttcacgctcggcggctcggacgcggtc
gactccgcggtgcgcttcatcacgcattacttcaacgcgaccggccgcccgtcgaagaag
cagatgatcgcgctcgagcgcggctatcacggctcgtcgtcgatcggcgccggcctgacc
gcgctgcccgcgttccaccgtcatttcgatctgccgcgcgccgatcagcaccatatcccg
tcgccctacccgtaccgccatccgctcggcgacgacccgcaggcgctgatcgccgcctcg
gtcgccgctctcgaggcgaaggtcgcggcgctcggcgccgacaacgtcgccgcgttcttc
tgcgagccgatccagggctcgggcggcgtgatcgtgccgccggcgggctggctgaaggcg
atgcgcgacgcgtgccggcgcctcggcatcctgttcgtcgccgacgaggtgatcacgggc
ttcggccgcaccggcccgctgttcgcgtgcgaaaccgaatccgtcgagccggacctgatg
accgtcgcgaaggggctcaccgccggctacgcgccgatgggcgcggtgctgatgtccgac
gaaatctacgaggggctcgccggcagccgtaccgaatcggccgtggtcggccatggtcat
acgtattccgcgcacccggtcagcgcggcgatcggcctcgaggtgctgaagctctatcac
gagggcgggctgctcgcgaacggccgcgcgcaggcgccgcgcttcgccgcggggctcgac
gcgctgcgcgcgcatccgctcgtcggcgacgcgcgctcagccggtctgctcggcgcgctc
gagctggtggccgacaaggcgcgcaagacgcgcttcgacccggcgctgaacgtgccggac
aagatcgccgcggccgcgtacgcgaacggcgtggtgtttcgcgcgttcggcgacggcgtg
ctcggcttcgcgccggcgctgagcttcaccgcgggagaattcgacctgatgttcgaacgc
gtgcgcaagacgctcgacgacgtgctggccgacccgggcgtgcaacgcgcgctcgacgcc
gcccacgcgcagccggcctga

DBGET integrated database retrieval system