KEGG   Burkholderia vietnamiensis G4: Bcep1808_6566Help
Entry
Bcep1808_6566     CDS       T00493                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00010  Glycolysis / Gluconeogenesis
bvi00620  Pyruvate metabolism
bvi00640  Propanoate metabolism
bvi00680  Methane metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep1808_6566
   00620 Pyruvate metabolism
    Bcep1808_6566
   00640 Propanoate metabolism
    Bcep1808_6566
  Energy metabolism
   00680 Methane metabolism
    Bcep1808_6566
Enzymes [BR:bvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcep1808_6566
Lipid biosynthesis proteins [BR:bvi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcep1808_6566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABO59461
UniProt: A4JT58
Position
3:1182357..1184351
Genome map
AA seq 664 aa AA seqDB search
MENTLTALVSILQESRIFEPTADTRARATISGMPAYRALVAEAEQDYEGFWARLARENLS
WHKPFTKVLDESNAPFCTWFDDGELNASYNCLDRHVEAGNGQRVAVIFEADDGTVTRVTY
AELLARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQACARIGATHSVVFGGFSAKS
LNERLVDVGAVALITADEQARGGKTLPLKSIADEAIAMGGCDAVKSVIVYRRTGGKIDWH
AGRDLWMHELADAESDHCPPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMK
WTFDWKPDDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIADHK
VSVFYTAPTAIRSLIKAADADDKVHPKSYDLSSLRIIGTVGEPINPDAWMWYHKHVGGER
CPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVV
KRPWPSMIRTIWGDPERFKKSYYPEELGGGLYLAGDGTVRDKDTGYFTIMGRIDDVLNVS
GHRLGTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGDEAAALAKALR
DWVGKQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQL
GLSL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaccttgaccgccctcgtatcgatccttcaggaaagccgaatcttcgaaccg
acggccgacacgcgcgcacgcgcgaccatttccggcatgccggcctaccgtgcgctcgtc
gccgaggccgagcaggactacgagggcttctgggcgcgtctcgcgcgcgagaacctgagc
tggcacaagccgttcaccaaggtgctcgacgagagcaacgcgccgttctgcacgtggttc
gacgacggcgagctcaacgcgtcgtacaactgcctcgaccgtcacgtcgaagccggcaac
ggccagcgcgtcgccgtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctac
gccgagctgctcgcgcgcgtgtcgcgcttcgccaatgcgctgaaaaaacgcggcatcggc
aagggcgatcgcgtcgtcatctacatcccgatgtcgatcgaaggcatcgtcgcgatgcag
gcctgcgcgcgcatcggcgccacgcactcggtcgtgttcggcggcttctccgccaaatcg
ctgaacgaacggctcgtcgacgtcggcgcggtcgcgctgatcaccgccgacgagcaggcg
cgcggcggcaagacgctgccgctcaagagcatcgccgacgaagcgatcgcgatgggcggc
tgcgacgcggtcaagagcgtgatcgtctatcgccgcaccggcggcaagatcgactggcat
gccgggcgcgatctgtggatgcacgagctcgccgacgccgagtccgaccactgcccgcca
gaatgggtcggcgccgagcatccgctgttcattctctacacctccggctcgaccgggaag
cccaagggtgtgcagcacagcaccggcggctacctgctgtgggccgcgcagacgatgaag
tggaccttcgactggaagcccgacgacgtgttctggtgtacggccgacatcggctgggtc
accggccacacgtacatcacctacgggccgctcgcatgcggcggcacgcaggtcgtgttc
gagggcgtgccgacctacccggacgccgggcgcttctggaagatgatcgccgaccacaag
gtcagcgtgttctataccgcgccgaccgcgatccgttcgctgatcaaggccgccgacgcc
gacgacaaggtccacccgaagagctacgacctgtcgagcctgcgcatcatcggcacggtc
ggcgagccgatcaatccggacgcgtggatgtggtatcacaagcacgtgggcggcgagcgc
tgcccgatcgtcgacacctggtggcaaaccgaaaccggcggccacatgatcacgccgctg
ccgggcgcgacgccgacggtgcccggttcgtgcacgctgccgctgccggggatcatggcc
gcggtggtcgacgagacgggccaggacgtgcccaacgggcaaggcgggatcctggtggtc
aagcgtccgtggccgtcgatgatccgcacgatctggggcgacccggagcgcttcaagaag
agctactaccctgaggagctcggcggcgggctgtatctggcgggcgacggcacggtgcgc
gacaaggacaccggttacttcacgatcatggggcgcatcgacgacgtgctgaacgtgtcg
ggccaccggctcggcacgatggagatcgagtcggcgctggtgtcgcacgagctggtggcg
gaagcggccgtggtcggccggccggacgacacgacgggcgaggcagtggtcgcgttcgtg
gtgctcaagcgctcgcgccctgaaggtgacgaggccgcggcgctggccaaggcgctgcgc
gactgggtcggcaagcagatcgggccgatcgcgaagccgaaggacatccgtttcggcgac
aacctgccgaagacgcgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaag
ggcgaggcgatcacgcaggacacctccacgctcgagaatccggcgattctggagcagctc
ggcctgtcgctctga

DBGET integrated database retrieval system