KEGG   Burkholderia vietnamiensis G4: Bcep1808_6751Help
Entry
Bcep1808_6751     CDS       T00493                                 

Definition
(GenBank) sex pilus assembly protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_6751
Secretion system [BR:bvi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcep1808_6751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ABO59639
UniProt: A4JTN6
Position
pBVIE01:complement(144369..145316)
Genome map
AA seq 315 aa AA seqDB search
MKLNKFVSLLLLGSLALPLFAQEPTDQSGRFLERKSEGWFWYKDPKDEVKKEVPPPPPPP
PSPEVDAKQQPAEKPDQPFSVEWLRKNMPRFLDAAINNPTKENVETYLYAQRVAMDKSQR
YAEMTQRVVAADPFLDENNRVPIAAYTKSFFLRQFNAGNAEALKHIAKVGGLWVFFDSKC
EYCRPQANSVQEITKKYGFVTKFISMDGKGLPNVTEFVKDKGQAKLLNLRLTPTTVLVVP
PNNYFIVSQGMMAQDQLEQRIVLAADSNNLLPPDIAKKIRTYDRGVLSNDDMQKGATKDP
KEWVKYLKDRLEGRY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataaatttgtatcgcttctgctgctcggatcgctggcactgccgctgttc
gcccaggagcccacagaccagtcaggccgattccttgagcgcaagtcagaagggtggttt
tggtacaaagaccccaaagacgaggtaaaaaaggaggtcccaccgcctccgccgccccct
ccttctccggaggttgatgccaagcagcaacccgccgagaagccggatcagcctttttca
gtcgaatggctgcgcaaaaacatgccgaggtttctcgatgctgccatcaacaatccgacc
aaggaaaacgtagaaacctatctctacgcccagcgtgtcgcgatggacaagtcgcagcgc
tacgcggagatgacgcagcgtgtcgtggccgccgacccgtttcttgacgaaaacaaccgc
gtgcctatcgcggcctatacgaaatcgttcttcctgcgtcagtttaatgcgggcaacgct
gaggcactcaagcacatcgcgaaggtcggcgggttgtgggtctttttcgattcgaaatgt
gagtattgccgaccgcaggcaaacagtgtccaagagatcaccaagaagtatggcttcgta
acgaagttcatctcgatggacggcaaaggactgcccaacgtaaccgagttcgtgaaggac
aagggccaagcaaagcttttgaacttgcgcctcacaccaacgacggttctcgtggttccc
ccgaacaactacttcattgtttcgcagggaatgatggcgcaggatcagctcgaacagcgg
atcgttctcgctgccgactccaacaacctgttgccaccggatatcgcaaagaagattcgc
acctacgatcgcggcgtgctttcaaacgacgacatgcagaagggtgcaaccaaagatccg
aaggaatgggtgaagtatctgaaagaccgcctcgaagggcgttactaa

DBGET integrated database retrieval system