KEGG   Burkholderia vietnamiensis G4: Bcep1808_7116
Entry
Bcep1808_7116     CDS       T00493                                 
Name
(GenBank) conserved hypothetical protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ABO59999
UniProt: A4JUP6
Position
pBVIE02:81120..82130
AA seq 336 aa
MRRGMMRQWLPSGLLLIALVLPTVARAALQDTLTQFGTTGWSSSYVVGEVAKGAMAAIEE
ITKLMTDLIDLAVTVSKSLEKDSDKMAGGLATITIIVAFLRFAATKDPVAAWGSAFEDLA
VLGIFASVYLAYGTWAPGFYKWFNDLAVAVSGTDAQSLPMAMVKSAGAIFDAVNEALKAE
HWWNYVALVINLIPLLAAWFILMVASLVFLFYVSLGTIQMAVAIVMGKIAFALGMSEFTR
GWFKSWLDFTIGAGMYMVVAAILQRLMTTTLATTFGNTISKGLTTPYAGSLTLDLSIFVL
ILAFEIPKFASMFGGGASASGAAFKSLTKLATKGMV
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaggcgcggaatgatgcgtcagtggctgccgagtggcctgcttctcatcgcgcttgtg
ctcccgacagtagcccgggctgccctgcaggatacgctaacccaatttggaacaaccggc
tggagttcaagctacgtggtcggcgaggtcgcgaagggcgcgatggcggcaatcgaagag
atcacgaaactgatgacggatctgatcgatctcgcagttacggtcagcaagtcgcttgag
aaagattcggacaagatggcgggagggcttgcgaccatcaccattatcgtggcgtttctc
cgtttcgcagcgacgaaggatccggttgccgcttggggcagcgcctttgaagaccttgcc
gtactcggcatcttcgcgtccgtctatctcgcctacggtacgtgggcgcccggcttctac
aagtggttcaacgacttggcggtcgcggtctcggggaccgacgcgcaatctctgccaatg
gcgatggtgaagtcggcaggggcaatattcgatgcggtcaatgaagcgctgaaggccgag
cactggtggaactacgtcgccctggtaatcaatctgattccgcttctcgccgcgtggttc
attctgatggtcgcatcgttggtgtttctgttctatgtctcgctcggcacgatccagatg
gctgttgcaatcgtgatggggaaaattgcgttcgcgctcggcatgtcggagtttacgcgt
ggttggttcaagagctggctcgatttcacgatcggcgctggcatgtacatggttgttgcc
gcgattcttcagcggctgatgaccaccacgcttgcgacgacattcggaaacaccatctcg
aaggggctgacgacaccctacgctggctctttgactctcgatctttcgatcttcgttttg
atcctcgcgttcgaaattccgaagtttgcctcgatgttcggtggcggcgccagcgcaagc
ggtgcggcgttcaagagcctgacgaaactggcgacgaagggcatggtttga

DBGET integrated database retrieval system