KEGG   Burkholderia vietnamiensis G4: Bcep1808_7605Help
Entry
Bcep1808_7605     CDS       T00493                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00362  Benzoate degradation
bvi00621  Dioxin degradation
bvi00622  Xylene degradation
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
bvi01220  Degradation of aromatic compounds
Module
bvi_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep1808_7605
   00622 Xylene degradation
    Bcep1808_7605
   00621 Dioxin degradation
    Bcep1808_7605
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Bcep1808_7605
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     Bcep1808_7605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ABO60478
UniProt: A4JW25
Position
pBVIE04:52257..53303
Genome map
AA seq 348 aa AA seqDB search
MNLQGKKITVHDMTLRDGMHPKRHLMTLEQMKSIACGLDAAGVPLIEVTHGDGLGGSSVN
YGFPAHSDEEYLGTVIPLMKQAKVSALLLPGIGTVDHLKMAKELGVHTIRVATHCTEADV
SEQHIALARKLEMDTVGFLMMAHMNSPEGLVRQAKLMESYGANCVYITDSAGYMLPDDVR
ARLGAVRDALKPETELGFHGHHNLAMGIANSIAAVECGATRIDAASAGLGAGAGNTPMEV
LVAVCDRMGIQTGVDVWAIQDVAEDLVVPIMDFPIRIDRDSLTLGYAGVYGSFLLFAKRA
EQKYGVPAREILVELGRRGMVGGQEDMIEDTAITLAKARASKAQKVAA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcaagggaaaaaaatcaccgtccacgacatgacgttgcgtgacggcatgcat
ccgaagcgccatttgatgacgctggagcagatgaaaagcatcgcctgcggcctggacgca
gccggggtccccctgattgaagtcacgcacggcgatggcctgggcggctcgtcggtcaac
tatggctttccggcccacagcgatgaagaatatctggggaccgtgatcccgctcatgaag
caggccaaggtctcggctttactgttgccgggcatcggcaccgtcgatcatctgaagatg
gccaaggagcttggcgtgcacaccatccgggtggccacgcactgcaccgaggctgacgtg
tcagagcagcacattgccctggcgcgcaagcttgagatggacacggtgggcttcctgatg
atggcgcatatgaacagtcctgaagggctggtcagacaggcaaagctgatggagtcatac
ggcgccaactgtgtctacattaccgattcggctggctacatgctgcccgatgatgtcagg
gcccgccttggcgcggtgcgcgacgcgctcaagccggagacggaactgggctttcacggc
caccacaatctggcgatggggatcgccaactccattgcggccgttgagtgtggcgccacc
cgcatcgacgccgcctcggctggtctcggtgcgggtgcgggtaacacaccgatggaggtg
ctggtcgccgtatgcgaccgaatggggattcagaccggagtggatgtgtgggccattcag
gacgtggccgaagacttggtcgtaccgatcatggacttccccatccggatcgaccgcgac
tcgctcaccctgggttacgccggggtctacgggtcgttcctgctgtttgccaagcgcgcc
gagcaaaagtatggcgtaccggcgcgcgagatcctggtcgagcttgggcgccggggcatg
gtcggtggccaggaagacatgattgaagacacggccatcacgctggccaaagcgcgtgcg
tcaaaggcgcagaaggtggcggcatga

DBGET integrated database retrieval system