KEGG   Brucella vulpis: BF3285c2_0004Help
Entry
BF3285c2_0004     CDS       T04257                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvl  Brucella vulpis
Pathway
bvl00071  Fatty acid degradation
bvl00072  Synthesis and degradation of ketone bodies
bvl00280  Valine, leucine and isoleucine degradation
bvl00310  Lysine degradation
bvl00362  Benzoate degradation
bvl00380  Tryptophan metabolism
bvl00620  Pyruvate metabolism
bvl00630  Glyoxylate and dicarboxylate metabolism
bvl00640  Propanoate metabolism
bvl00650  Butanoate metabolism
bvl00900  Terpenoid backbone biosynthesis
bvl01100  Metabolic pathways
bvl01110  Biosynthesis of secondary metabolites
bvl01120  Microbial metabolism in diverse environments
bvl01130  Biosynthesis of antibiotics
bvl01200  Carbon metabolism
bvl01212  Fatty acid metabolism
bvl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF3285c2_0004
   00630 Glyoxylate and dicarboxylate metabolism
    BF3285c2_0004
   00640 Propanoate metabolism
    BF3285c2_0004
   00650 Butanoate metabolism
    BF3285c2_0004
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BF3285c2_0004
   00072 Synthesis and degradation of ketone bodies
    BF3285c2_0004
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF3285c2_0004
   00310 Lysine degradation
    BF3285c2_0004
   00380 Tryptophan metabolism
    BF3285c2_0004
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF3285c2_0004
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BF3285c2_0004
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BF3285c2_0004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvl04147]
    BF3285c2_0004
Enzymes [BR:bvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BF3285c2_0004
Exosome [BR:bvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF3285c2_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CUW44890
UniProt: A0A0U5MRA1
Position
2:complement(2990..3700)
Genome map
AA seq 236 aa AA seqDB search
MGTFAEDCAEAYQFTREAQDAFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTID
EQPGKAKLDKIPTLRPAFREGGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITG
HATYADKPNLFSTAPIGAIRKLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKV
NIHGGACALGHPIGASGARILVTLLAALETHGLKRGVAGICLGGGEATAMGIERII
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgtttgcggaagattgcgccgaggcttaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccctgccttccgcgaa
ggcggcacggtaacggcagccaactcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaagcgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccctattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcccttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcgtcgcgggcatc
tgccttggcggcggcgaggcaaccgccatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system