KEGG   Brucella vulpis: BF3285c2_0589Help
Entry
BF3285c2_0589     CDS       T04257                                 

Gene name
uppP
Definition
(GenBank) UDP pyrophosphate phosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
bvl  Brucella vulpis
Pathway
bvl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BF3285c2_0589 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bvl01011]
    BF3285c2_0589 (uppP)
Enzymes [BR:bvl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     BF3285c2_0589 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:bvl01011]
 Precursor biosynthesis
  Diphosphatase
   BF3285c2_0589 (uppP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: CUW45467
UniProt: A0A0U5MY60
Position
2:610764..611570
Genome map
AA seq 268 aa AA seqDB search
MDFFNLLEAAFLGLIEGLTEFIPVSSTGHLLLIGHFLGFESTGKTFEVLIQLGAILAILS
VYSAKLAKIATDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLI
VGGFILLWVDQLNLRPRYHNVMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGAD
KRSAAEFSFFLAMPTMAGAFAYDLFKSRNILSFNDGALIVVGFIMAFISGVFVVRHLLDY
VSRHGFALFGWWRLIVGSAGMAALIIWG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatttttttaatctgctggaagccgcgtttctcggtctcatagaaggcctaaccgaa
ttcataccagtttcctccacaggacacctcttgctgatcggtcattttctgggttttgaa
tcgacggggaaaaccttcgaggttctgatccagcttggcgcaattctcgccatcctgtcc
gtctattcggcaaagcttgccaagattgccacggattttccacgcgatgcgcgcacacgc
cggtttgttctgggggtgctggtcgccttcctgcctgccgccgttatcggtgcgctggcg
catggcttcatcaagggtgtgctgtttgaaacgccgatgctggtctgcatcatgttgatt
gtcggcggtttcatcctgctctgggtggatcagctcaacctgcgcccgcgctatcataat
gtgatggattatccgctgccgatctgtcttgccatcgggttcatccagtgccttgccatg
ataccgggtgtttcacgttccggctccaccattgtcggctcgctgctgctcggtgccgac
aagcgttcggcggcggagttctccttcttccttgccatgcctaccatggcaggtgccttt
gcctatgatcttttcaagagccgcaatattctctcgttcaacgatggcgcgctgatcgtc
gtaggctttatcatggctttcatttcgggtgtcttcgtcgtgcgccacctgctcgactat
gtgtcccgccacggctttgcgctgtttggctggtggcgcctgatcgtcggttcggcagga
atggcggcactgattatctgggggtaa

DBGET integrated database retrieval system