KEGG   Brucella vulpis: BF3285c2_1021Help
Entry
BF3285c2_1021     CDS       T04257                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bvl  Brucella vulpis
Pathway
bvl00430  Taurine and hypotaurine metabolism
bvl00620  Pyruvate metabolism
bvl00640  Propanoate metabolism
bvl00680  Methane metabolism
bvl01100  Metabolic pathways
bvl01120  Microbial metabolism in diverse environments
bvl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF3285c2_1021 (ackA)
   00640 Propanoate metabolism
    BF3285c2_1021 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BF3285c2_1021 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BF3285c2_1021 (ackA)
Enzymes [BR:bvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BF3285c2_1021 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase PRA-PH
Motif
Other DBs
NCBI-ProteinID: CUW45890
UniProt: A0A0U5IHA9
Position
2:complement(1034502..1035707)
Genome map
AA seq 401 aa AA seqDB search
MNKQLVTFNAGSSTVKIGVFECDGNAVRKVSKGDIDLTGSPLRFRLRGENGNLDIVLSAS
GTDDITTILGELFDKLAEHIDPSRILAVGHRVVFGGDDFAQAVLIDDDNLEAIERLSIFA
PLHQPKSLALIKAVRKIFPHLAQTASFDTAFHQTIPDTVRRFAIPQELHDRGIKRFGFHG
LSYKSIIGNFSQRAPELAEGKIIAAHLGSGASLCAMHKRKSLDTSMSFSTLDGIPMATRC
GALDPGVLLHLLQQEKMEADALADLLYHRSGLLGLSGLSGDTRDLLESDAPQARAALDIF
ALRIAGEICRLASTLNGLDAVIFTAGIGEHQPAIRAAICQRLAWQGVELDPAANDENAFC
ITSRTSRTAAFVLPTDEEQIIASETFEIIRQMPATARSAFA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagcagcttgttaccttcaatgcgggttcttccacggtaaagatcggcgtattc
gaatgcgatggaaacgcggtccgcaaggtttcaaaaggcgatatcgacctgacgggatca
cccttgcgattccggctgcgtggcgaaaatggcaatctggacatagtcttgtcagccagc
ggcacggacgacatcaccaccatattgggtgaacttttcgacaagcttgccgaacatatc
gacccgtcacgcatattggctgttggccaccgtgtcgttttcggcggcgacgattttgcg
caagccgtgcttatcgacgacgacaatcttgaggccatcgaacgcctatcgattttcgcg
cccctgcatcagcccaagagcctcgccctcataaaagccgtcagaaagatattcccgcat
cttgcacagacggcatccttcgacacggcctttcaccagaccatccccgataccgtgcgc
cgctttgccattccgcaggaactgcatgatcgcggcatcaagcggttcggctttcacggg
ctttcctataaatccatcatcggcaatttttcacagcgcgcgccggagcttgcggaaggg
aagatcattgccgcgcatctgggaagcggcgccagcctttgcgccatgcacaagcgtaag
agtctcgataccagcatgagcttttccacgcttgatggaattcccatggcaacacgatgc
ggggcgctggaccccggcgtgcttctccatttgctgcaacaggaaaaaatggaggccgat
gcgcttgccgaccttctctatcaccgttccggcctgcttggcctttcgggcctgagcggc
gacacgcgggacctgctcgaaagtgatgcgccgcaggcgcgcgcggcgctcgatatattc
gcgctgcgcattgccggggaaatctgccgccttgcctcaacgctcaatggccttgatgcc
gtgatttttaccgcaggcatcggcgaacaccagcctgcgataagagccgccatatgccag
cgcctcgcctggcaaggcgtcgaactggaccctgcggcaaatgatgaaaatgctttctgc
atcaccagccgcacaagccgcacggccgcattcgttctgccaaccgacgaagaacagatc
atcgcctcggaaacatttgaaatcattaggcaaatgccagcaaccgccagaagcgcgttc
gcataa

DBGET integrated database retrieval system