KEGG   Bacillus vallismortis: B9C48_00755Help
Entry
B9C48_00755       CDS       T04948                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bvm  Bacillus vallismortis
Pathway
bvm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B9C48_00755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bvm03011]
    B9C48_00755
Ribosome [BR:bvm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B9C48_00755
  Bacteria
    B9C48_00755
  Archaea
    B9C48_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARM26462
UniProt: A0A1W6HE69
Position
139050..139391
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggtaagcaagtaggcgaagcagtatctatcctgaacttaactccg
agagctgcttctccgatcatcgaaaaagttttaaaatctgctatcgcaaatgctgagcac
aactacgagatggacgctaacaatctggttatttctcaggcatttgttgacgaaggccca
acgttaaaaagattccgcccgcgtgctatgggacgtgcgagccaaatcaacaaacgtacg
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system