KEGG   Bacillus vallismortis: B9C48_02140Help
Entry
B9C48_02140       CDS       T04948                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00051  Fructose and mannose metabolism
bvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B9C48_02140
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     B9C48_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ARM26704
UniProt: A0A1W6HF40
Position
419545..420666
Genome map
AA seq 373 aa AA seqDB search
MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNERKEYTVELADGGRQTEII
GPVSAINSAVQEQELYGLINEAAIITTAVGPNVLRLIAPSIAEGLKRRTSSEPLNIIACE
NMIGGSSFLKKEVFGHLTDAERELVNRTVGFPDSAVDRIVPIQHHEDPLKVSVEPFFEWV
IDRTGFAGGQPVLKGALFTDDLTPFIERKLFTVNTGHAVTAYVGYQRGLKTVKEAIGHPE
IRRVVYDALSETGEYLVKAYGFKQSEHEQYMKKIIGRFENEYITDDVTRVARSPLRKLGA
NDRLVGPAKKIKEPNALAEGIAAALRFDYQDDPEAVELQKLIAEKGTSRVLQDICGIQPH
EPLHGIVLKKLNQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttcatttcggagcgggaaacatcggacggggctttatcggcgccctgctc
catcattccggctatgacgtagttttcgctgatgtgaatgaaacgatggtcagccttctc
aatgaaaggaaggaatataccgtggagcttgccgacggcggccggcagacagaaatcatc
ggccctgtttcagccatcaacagcgcggtgcaagaacaagagctgtacgggctgatcaat
gaagcggcgatcattacgacggcggtgggcccgaacgttctcagactcatcgccccgtcc
atcgcggaagggctgaagcgcagaacgtcttctgagcctctcaatatcattgcctgtgaa
aatatgatcggcggtagcagttttctgaaaaaagaagttttcggacatttgacggatgcg
gagcgggaactcgtgaaccggacggtcggcttcccggattctgcggtagatcggatcgtg
ccgattcagcaccatgaagatccgctgaaagtatccgtagaaccgttttttgaatgggtc
atagacagaaccggctttgccggcggccagccggtacttaaaggcgcgttgtttacggat
gatcttacgcctttcatcgagagaaagctgtttaccgtcaataccggtcatgccgttacg
gcgtacgtcggctatcagcgcggattaaaaaccgtcaaagaggccatcggccatccggaa
atccggcgtgtcgtgtacgatgcactttcagaaacgggcgagtacttggtgaaagcgtac
ggctttaagcaatccgaacacgagcagtacatgaagaaaatcatcggccgctttgaaaat
gaatacatcacggatgatgtgacaagagtcgccagatcaccgctcagaaaactcggagcg
aatgacagattagtagggccggctaaaaaaataaaagaaccgaacgcgctggcagaaggc
atcgccgccgccctgcgctttgactatcaggatgatccggaagcggttgagctgcaaaag
cttatcgcggaaaaaggcacgagccgcgttcttcaagacatttgcggtattcagccgcat
gaaccgctgcacggcatcgtgctcaaaaagctcaatcaataa

DBGET integrated database retrieval system