KEGG   Bacillus vallismortis: B9C48_03300Help
Entry
B9C48_03300       CDS       T04948                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B9C48_03300
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B9C48_03300
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B9C48_03300
    1.1.1.-  
     B9C48_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ARM26903
UniProt: A0A1W6HFG5
Position
complement(624193..625233)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGKPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcaaacctcatccgttaaca
aacgaaatggctcccgtcacgatgggtcacgaattctcaggagaagtcgtggaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacaccagggagcctataaccttgatgaacaaatgggattcttaggcttagccgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcgcttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattgaaagcgggcgacaaggcggcagtttttggctgcggaccgatc
gggctgcttgtgattgaagccctgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgcacaaacggcggcgttgatgtttct
tatgaagtaacaggcgttcctgtcgttctccgccaggcgatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatctgggaaaaaggagcggaaattcatccgaacgatatc
gtcatcaaagaacggaccgtaaaaggcattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaatcgtg
ctcgacgatctgattgaagaaggcttcggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system