KEGG   Bacillus vallismortis: B9C48_05280Help
Entry
B9C48_05280       CDS       T04948                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00071  Fatty acid degradation
bvm00072  Synthesis and degradation of ketone bodies
bvm00280  Valine, leucine and isoleucine degradation
bvm00310  Lysine degradation
bvm00362  Benzoate degradation
bvm00380  Tryptophan metabolism
bvm00620  Pyruvate metabolism
bvm00630  Glyoxylate and dicarboxylate metabolism
bvm00640  Propanoate metabolism
bvm00650  Butanoate metabolism
bvm00900  Terpenoid backbone biosynthesis
bvm01100  Metabolic pathways
bvm01110  Biosynthesis of secondary metabolites
bvm01120  Microbial metabolism in diverse environments
bvm01130  Biosynthesis of antibiotics
bvm01200  Carbon metabolism
bvm01212  Fatty acid metabolism
bvm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B9C48_05280
   00630 Glyoxylate and dicarboxylate metabolism
    B9C48_05280
   00640 Propanoate metabolism
    B9C48_05280
   00650 Butanoate metabolism
    B9C48_05280
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B9C48_05280
   00072 Synthesis and degradation of ketone bodies
    B9C48_05280
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B9C48_05280
   00310 Lysine degradation
    B9C48_05280
   00380 Tryptophan metabolism
    B9C48_05280
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B9C48_05280
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B9C48_05280
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B9C48_05280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvm04147]
    B9C48_05280
Enzymes [BR:bvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B9C48_05280
Exosome [BR:bvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B9C48_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARM27254
UniProt: A0A1W6HGN2
Position
complement(1016911..1018002)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTAIDRQCGSGLDAVRIACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKAHEDGLYRREILPCHG
FAADENMLKKRNMAPLIARAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
GLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaagcggacgattttcgcccgggaaaacggcctgtta
aaagactgtctccccgaagatttggcagctccgctgatccgacatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaacctcgcc
cggctgtcagccttggccgccgggcttcctttgagcgtgtccggtacggccatcgacagg
cagtgcggttccggattggacgccgtgagaatcgcgtgccactttgttaaagccggcgcg
gggagcacatacatcgcgggaggagcggagagcagcagccgttcccctttctcatcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcggccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcacacgaagacggcttgtaccgccgggaaattctcccctgccacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggcgcctctcatcgcccgcgcc
aaacccgtctttcagtccggaggctctgtaaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcgatctctcggtttaaagccg
ggattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggaacgggacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgccctgatgcc
cgctatgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system