KEGG   Bacillus vallismortis: B9C48_05840Help
Entry
B9C48_05840       CDS       T04948                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bvm  Bacillus vallismortis
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bvm03009]
    B9C48_05840
Enzymes [BR:bvm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     B9C48_05840
Ribosome biogenesis [BR:bvm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B9C48_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 TGS WYL_3
Motif
Other DBs
NCBI-ProteinID: ARM27358
UniProt: A0A1W6HH32
Position
1123999..1124892
Genome map
AA seq 297 aa AA seqDB search
MDNFFIQKNMTAREAGMTVKEYTAQLGISKRLLADIKFGGGDLLVNGEHVTVRTVLTDGD
VLKIEFPKEHVSETLLPEPVPLDILYEDDHVLVVNKQPYVSSIPSREHPSESIANGVISH
YRKSGVQSTVHLVTRLDRDTSGAMLIAKHRLSHSLLSAAQKKGLVSRRYLAVVHGIMMQK
EGTVDAPIGRKHDSIIERMVTPEGQRAVTHFQTEKSGHAFTLAALRLETGRTHQIRVHMS
YLGHPLVGDTLYGGKNEGIARQALHSERLSFVHPMTGETLVFHAPVPDDMKTLIEHM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttggacaacttttttatccaaaagaacatgactgcccgggaagctggcatgacggtaaaa
gaatatacggcgcagctcggcatttcaaagcggcttctcgctgacattaaattcggcggg
ggagacctgcttgtgaacggagagcatgtaaccgtccgcaccgtgttaacggacggagat
gtgcttaagattgaatttccgaaggagcatgtgagtgaaacgcttttgcctgagccggtt
ccgcttgatattctttatgaagatgaccatgtgcttgtggtcaataaacagccgtatgtc
tcctcaattccatcaagagaacacccgtcggaaagcatcgctaacggagtgatcagccac
taccgaaaaagcggcgtacaatcaacggttcatcttgtcacccgccttgacagggataca
tcgggggcgatgctcatcgccaaacatcggctttcccattctcttttgtcggcagcgcag
aagaaggggcttgtcagcaggcggtatctcgctgtcgtacacgggatcatgatgcagaag
gaaggaacggtggacgcgcccatcggaagaaaacacgacagtattattgagcggatggta
acgccggagggacaacgagcggtgacgcattttcaaacggaaaaatcgggacatgcgttt
acgcttgcagccctgcggctggaaacggggcggacgcatcaaatccgggtgcacatgagc
tacctcggccatcctttagtcggtgatacattgtacggcggaaaaaatgagggaattgcg
cggcaggctcttcacagtgagcggctttcattcgtacaccccatgaccggagaaacgctc
gtttttcacgctccggtgcctgacgatatgaaaacattaattgaacacatgtaa

DBGET integrated database retrieval system