KEGG   Bacillus vallismortis: B9C48_10195Help
Entry
B9C48_10195       CDS       T04948                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00480  Glutathione metabolism
bvm00590  Arachidonic acid metabolism
bvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    B9C48_10195
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B9C48_10195
Enzymes [BR:bvm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     B9C48_10195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ARM28177
UniProt: A0A1W6HJE8
Position
complement(2121591..2122073)
Genome map
AA seq 160 aa AA seqDB search
MTIYDINVRTITGEDMMLSTYRGKVMIIVNTASKCGFTSQLKQLQELYDTYREEGLEILG
FPCNQFMNQEPGNEAEIQEFCVKNYGVTFPMFAKVDVNGADAHPLFTYLTEQAKGMLGTK
AVKWNFTKFIVDRNGEVTGRFSPNVNPKELEDTVQRLLAQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttacgatataaacgtacggaccataacaggcgaagacatgatgctatcgact
tacagaggcaaggtgatgatcattgtgaatacagcaagcaaatgcgggttcacatcccag
ctcaagcagcttcaggagctctatgatacatatcgggaggaaggtcttgaaatattggga
tttccctgcaaccaattcatgaaccaagaacctggaaacgaagcggaaattcaagagttc
tgtgtgaaaaactacggagtcacattcccgatgtttgcaaaagtcgatgtcaatggagca
gacgctcatcctctcttcacatatctgacggaacaggcaaaggggatgctcggcacaaaa
gcggtcaaatggaatttcactaagtttatcgtggaccgaaacggtgaagtcaccgggcgt
ttttcaccgaacgtcaacccaaaagagcttgaagatacggtgcagaggcttttggcccaa
taa

DBGET integrated database retrieval system