KEGG   Blastochloris viridis: BVIR_1680Help
Entry
BVIR_1680         CDS       T04109                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvr  Blastochloris viridis
Pathway
bvr00071  Fatty acid degradation
bvr00072  Synthesis and degradation of ketone bodies
bvr00280  Valine, leucine and isoleucine degradation
bvr00310  Lysine degradation
bvr00362  Benzoate degradation
bvr00380  Tryptophan metabolism
bvr00620  Pyruvate metabolism
bvr00630  Glyoxylate and dicarboxylate metabolism
bvr00640  Propanoate metabolism
bvr00650  Butanoate metabolism
bvr00900  Terpenoid backbone biosynthesis
bvr01100  Metabolic pathways
bvr01110  Biosynthesis of secondary metabolites
bvr01120  Microbial metabolism in diverse environments
bvr01130  Biosynthesis of antibiotics
bvr01200  Carbon metabolism
bvr01212  Fatty acid metabolism
bvr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVIR_1680
   00630 Glyoxylate and dicarboxylate metabolism
    BVIR_1680
   00640 Propanoate metabolism
    BVIR_1680
   00650 Butanoate metabolism
    BVIR_1680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BVIR_1680
   00072 Synthesis and degradation of ketone bodies
    BVIR_1680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BVIR_1680
   00310 Lysine degradation
    BVIR_1680
   00380 Tryptophan metabolism
    BVIR_1680
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BVIR_1680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BVIR_1680
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BVIR_1680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvr04147]
    BVIR_1680
Enzymes [BR:bvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BVIR_1680
Exosome [BR:bvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVIR_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALK09459
UniProt: A0A0H5BHM1
Position
complement(1842545..1843798)
Genome map
AA seq 417 aa AA seqDB search
MSTTEVGGAVTLAFDGVFVVDGARTPFVDYNGALAGVSPIDLGIKAGRAAIARAGVDPAE
IGTVVAGNMAQASFDAYFLPRHVGIYCGVPIEVPAHLVQRICGSGIEAVSQAADAVALGR
ARVALAVGTESMSRNPVAAYTHRGGFRLGQIEFGDFLWESLLDTSCATTMGGTAENLAKR
HGISREEVDAFAARSFARALAARADGFFEDEIVPVADETFERTGYNTRAIRLKVRGEPVR
EDSHVRPSPLEALAKIRPAFGGVQTGGNSSAVVDGAAAVVLASHDWVRAAGARPLARVVA
AASVGVPPEIMGIGPVPAIRAVCAKAGVALAEVGRIEINEAFGAQVMACARELGLDEDKL
NVNGGAIAIGHPLGATGVRLVVTVARELRRRGLKYGIASACIGGGQGIAMLVENPAV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgacagaagttgggggagcggtgacgctcgcgttcgacggcgtgttcgtcgtc
gatggcgcacgcacgccgttcgtcgattacaacggcgcgctggccggcgtgtcgccgatc
gatctcggcatcaaggccggccgcgccgccattgcccgtgctggggtcgatccggccgag
atcggcacggtggtggccggcaacatggcgcaagccagctttgatgcctattttctgccg
cgccatgtcgggatctattgcggggtgccgatcgaggtgccggcccatctggtgcagcgc
atctgcggctccggcatcgaggcggtatcgcaggcggccgatgcggtggcgctcggccgc
gcccgcgtcgcgctcgcggtcggcaccgagtcgatgagccgcaatccggtggcggcgtac
acccatcgcggcggcttccggctcggccagatcgagttcggcgacttcttgtgggagagc
ctgctcgatacctcctgcgccaccaccatgggcggcactgcggagaatctggcgaagcga
cacggcatcagccgcgaggaggtcgatgccttcgccgcacgctcgttcgcgcgggcgctc
gcggcccgagccgatggcttcttcgaagacgagatcgttccggtggccgacgagacgttc
gagcgcactggctacaacacccgcgccatccgcctgaaggtgaggggcgagccggtgcgc
gaggacagccacgtgcggccatcgccgcttgaagcgctggcgaaaatccgccctgcgttc
ggaggggtgcagaccggcggcaactcctcagcggtggtcgacggggcggcagcagtggtg
ctggcctcgcacgattgggtgcgtgccgccggggcgcggccgctggcccgcgtcgtcgcc
gccgcctcggtgggcgtgccgccggagatcatgggcatcggtccggtgccggcgatccgc
gcggtgtgcgcgaaggcgggcgtcgcgctcgccgaagtcggccgcatcgagatcaacgag
gcgttcggcgcccaggtgatggcgtgcgcgcgcgagcttggcctcgacgaagacaagctc
aacgtcaatggcggcgcgattgccatcggtcatcccttgggcgccaccggggtgcggctg
gtggtgacggtggcgcgcgaactgcgacggcgcggcctgaaatacggcatcgcgtcggcc
tgcatcggcggcggccagggcatcgccatgctggtggaaaacccggcagtctga

DBGET integrated database retrieval system