KEGG   Blastochloris viridis: BVIR_2644Help
Entry
BVIR_2644         CDS       T04109                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bvr  Blastochloris viridis
Pathway
bvr00020  Citrate cycle (TCA cycle)
bvr00310  Lysine degradation
bvr00380  Tryptophan metabolism
bvr01100  Metabolic pathways
bvr01110  Biosynthesis of secondary metabolites
bvr01120  Microbial metabolism in diverse environments
bvr01130  Biosynthesis of antibiotics
bvr01200  Carbon metabolism
Module
bvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVIR_2644
  09105 Amino acid metabolism
   00310 Lysine degradation
    BVIR_2644
   00380 Tryptophan metabolism
    BVIR_2644
Enzymes [BR:bvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BVIR_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ALK10409
UniProt: A0A0H5BBS8
Position
complement(2928104..2929336)
Genome map
AA seq 410 aa AA seqDB search
MTMEIRVPTLGESVTEATIGRWFKKPGEAVSADEPLVELETDKVTVEVPAPAAGVLAEVL
AKPGDTVGVGAVLGLLQEGAGSAKPAAKPAAAAAPAAAPAQAAARPLSDSGPAVRRIAAE
SGINPAAVAGTGRDGRVTKGDMLAAASALAPARAPAPTPAPAPAAPIKVRAPAAADDSAR
EERVRMSKLRQTIARRLKEAQNTAAMLTTFNDVDMSAVMNLRNEYKTQFEKKHGAKLGFM
GFFVKACVQALREMPAVNAEIDGDDIVYKNYYHIGVAVGTDKGLVVPVVRDADRLTIAEI
EKVITSYGKRARDGQLTIEEMQGGTFTITNGGVYGSLMSTPILNAPQSAILGMHRIEERP
VVRNGQVVVRPMMYLAVSYDHRIIDGKDAVTFLVRVKEALEDPTRLVLDV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggaaatccgcgtccccacccttggcgagtcggtcaccgaggccaccatcggc
cgctggttcaagaagcccggcgaggccgtcagcgccgacgagccgctggtggaactggaa
accgacaaggtcaccgtcgaggtgccggcgccggccgccggcgttctggccgaggtgctg
gccaagcccggcgacaccgtcggcgtcggcgcggtgctcggcctgctgcaggaaggcgcc
ggcagcgccaagccggccgcaaagccggcagcggcggctgcgcccgctgctgcgccggct
caagcggcggcgcggccgctcagtgacagcggcccggcggtgcgccgcatcgccgccgaa
agcggcatcaacccggctgccgtcgccggcaccggccgggacggccgcgtcaccaagggc
gacatgctcgccgcggcgtcggcactggcgccagcccgtgcccccgcgccgaccccggcc
ccggctccggccgcgccgatcaaggtgcgcgcgccggctgcggccgacgacagcgcgcgc
gaggaacgggtgcggatgagcaagctgcgccagaccatcgcgcggcggctgaaggaggcg
caaaacaccgcggcgatgctgacgacgttcaacgacgtcgacatgagcgcggtgatgaac
ctgcgcaacgaatacaagacgcaattcgagaagaagcacggcgccaagctcggcttcatg
ggcttcttcgtgaaggcgtgcgtgcaggcgctgcgcgagatgccggcggtcaatgccgag
atcgacggcgacgacatcgtctacaagaattactaccacatcggcgtcgccgtcggcacc
gacaagggcctggtggtgccggtggtgcgcgacgccgaccgcctcaccattgccgagatc
gagaaggtgatcacgtcttacggcaagcgcgcccgcgacggccagctcaccatcgaggag
atgcagggcggcaccttcaccatcaccaatggcggcgtctatggctcgctgatgtcgacg
ccgatcctcaacgcgccgcagtcggccattctcggcatgcaccgcatcgaggagcgtccg
gtggtgcggaacggccaggtggtggtgcggccgatgatgtatctcgccgtcagctacgac
caccgcatcatcgacggcaaggacgccgtcaccttcctggtgcgcgtgaaggaagcgctg
gaggatccgacccggctggtgctggacgtgtga

DBGET integrated database retrieval system