KEGG   Blastochloris viridis: BVIR_717Help
Entry
BVIR_717          CDS       T04109                                 

Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bvr  Blastochloris viridis
Pathway
bvr00620  Pyruvate metabolism
bvr00630  Glyoxylate and dicarboxylate metabolism
bvr01100  Metabolic pathways
bvr01110  Biosynthesis of secondary metabolites
bvr01120  Microbial metabolism in diverse environments
bvr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVIR_717
   00630 Glyoxylate and dicarboxylate metabolism
    BVIR_717
Enzymes [BR:bvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BVIR_717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ALK08511
UniProt: A0A0H5B7Q2
Position
complement(791519..794518)
Genome map
AA seq 999 aa AA seqDB search
MATTSGKSSGTASRRSAGKPARPGQTTDGDTKASKAKATKAATRASAAKSAVAKPRTNAA
PVKQAAKAATKTTAGKSAARSTKTAARPAAKTATKSPTRTAAKSAAKAPAKAKAATGKGA
GATKRIAAKPGKAPAAKTTARKASAAKPSARTTTTAKAATGKAGAGKAATAKTAKAKTAK
AKAAAAKRGNTATAKAKTTKTANTTRAATKATARKTAAGKTATKAATRKTAATKPATTKT
AAAKTAAAKAKQAAAKKPARAASPARGRAATAKTATRTTTTAKPAKTAKAATPTKTKTKP
ATKTKAATQTKPKTKAATKPAAKTKATTKAKATTKTPTKATAAKAAPARGRSASTAVQRP
AAASKRAAAKPTAAKTTPTKTTAAKTTATKPAATKRGAAKPATPALPASRPASRASRAAT
ATRRTAQAERRSAPPPTVRRGAGPAEAKRPATAPSTRPAKPRTTPAPRKAAMPDGVKVLG
KLAPRFEEILTAEALGFIAALHRRFDGRRRDLLKARAERQARFDAGELPDFLPETRHIRQ
HPWKVAAIPPDLHDRRVEITGPTDRKMIINALNSGAKVFMADFEDANSPTWANMVEGQIN
LKDRWHSAVFDHTDPDTGKRYELGDDPAVLMVRPRGLHLVERHLEVDGAPVAGSLFDFGL
YAFHNAKAALADGSGPYLYLPKLESHLEARLWNEVFLHTESTLGIHRGTIKATVLIETLP
AAFEMHEILHELKDHVAGLNCGRWDYIFSFIKTLAQTPDFILPDRGQVVMGKAFLKAYAQ
LLIQTCHMRGAFAIGGMAAQIPIKDDPERNEAAFAKVRADKEREAGDGHDGTWVAHPDLV
PVAMAVFDRLMPGKNQLDELREDVDFGQAELLEVPQGTRTEAGFRENIRVGVRYIEAWLS
GKGAVPLYNLMEDAATAEIARAQIWQWVKYGAKLDDGTQITPALFETVLHEEMARLRQEI
GAEAFDYGRFAEATQLFHKLSLAAEFEAFLTIPAYALID
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgtcagggaaatccagcgggacagcttcgcgccgcagcgccggcaaaccg
gcgcgccctggacagaccactgacggcgacaccaaggcgtcgaaagccaaggcgaccaaa
gccgccacgcgcgccagcgccgccaaatccgctgtggcaaagccccgcaccaatgcggct
ccggtcaagcaggctgccaaagctgcgaccaagacgacggccggcaagtccgcggcgcgg
tcgacgaagacggccgccagacccgcggcgaagaccgcgacgaaaagcccgaccaggacc
gccgccaagtccgcggcgaaagccccggcgaaagcgaaagccgcgaccggcaagggcgcc
ggcgcgacgaagcggatcgcagcgaaacccggcaaggcacccgcagcgaagacgaccgcc
cgcaaagcgagcgcggccaagccgagcgcgcgcacaacgaccacagcgaaggctgccacc
ggcaaggccggcgccggcaaagctgcgacggccaagactgcaaaggccaagactgcaaag
gccaaggccgcggcggccaagcgcggcaacaccgcgacggccaaagccaagacgaccaag
accgccaacacgaccagggccgcaaccaaggcgaccgcccgcaaaaccgcggcgggcaaa
acggcaaccaaggccgcgacgcgcaaaaccgccgcgaccaaacctgccacgaccaagact
gctgcggccaagactgctgcggccaaggcgaagcaggcggcagccaaaaagcccgcccgc
gccgcgagccctgcccgaggccgggccgcgaccgcgaaaaccgcgacccggacgacgacg
accgccaaaccggccaagacggcgaaagccgcaacgccgaccaagaccaaaaccaagccc
gcgaccaaaaccaaggccgccacccaaaccaagcccaagaccaaggccgcaaccaagcct
gccgccaaaaccaaggccaccaccaaggccaaggcgaccaccaagacccccaccaaggcc
accgccgccaaggcagcgcccgcccgcggtcgcagtgcttcaactgccgttcagcgtccc
gcggcagcgtcgaaacgggcagccgccaagccgacggcggcgaagacaacgccgacgaag
accaccgcagcaaagaccactgcgacgaagcccgcagcgaccaagcgtggcgcggccaaa
ccggcgacgccggcgctgcccgccagccggccggcctcgcgcgccagccgcgccgcgacc
gccacccggcgcaccgcccaggccgagcgccgctccgcgccgccgccgacggtgcgtcgc
ggggccggcccggccgaggccaagcgcccagccaccgctccgtccacacggccggccaag
ccgcgcaccacgccggcgccgcgcaaggcggcgatgccggacggcgtcaaggtgctgggc
aagctcgcgccacggttcgaggagatcctcaccgccgaagcgctcggcttcatcgccgcg
ctgcaccgccgtttcgacggccggcggcgcgatctcctgaaggcgcgcgccgagcggcag
gcccggttcgacgccggcgagctgcccgatttcctgcccgagacccggcacatccgccag
catccctggaaggtcgcggcgatcccgcccgacctccacgaccgccgggttgagatcacc
ggcccgaccgaccgcaagatgatcatcaacgccctcaattccggggcgaaggtgttcatg
gccgatttcgaggacgccaactcgccaacctgggccaacatggtcgagggccagatcaac
ctgaaggaccgctggcactcggcggtgttcgaccacaccgacccggacaccggcaagcgc
tacgaactcggcgacgacccggcggtgctgatggtgcggccgcgcgggctgcatctggtc
gagcgccaccttgaggtcgacggcgcgccggtcgccggcagcctgttcgacttcggcctc
tacgccttccacaacgccaaggcggcgctggccgacggctcggggccctatctctatctg
cccaagctcgaaagccaccttgaggcgcggctgtggaacgaggtgttcctgcacaccgag
tcgacgctcggcatccaccgcggcaccatcaaggccaccgtgctgatcgagacgctgccg
gcggcgttcgagatgcacgagatcctgcacgagctgaaagaccacgtcgccgggctcaat
tgcggacggtgggactacatcttctcgttcatcaagacgctggcgcagacgcccgacttc
atcctgcccgaccgcggccaggtggtgatgggcaaggcgttcctgaaagcctacgcccag
ctcctgatccagacctgccacatgcgcggcgcgttcgcgatcggcggcatggcggcgcag
atcccgatcaaggatgacccagagcgcaacgaagccgccttcgccaaggtgcgcgccgac
aaggagcgcgaggccggcgacggccacgacggcacctgggtcgcgcaccccgatctggtg
ccggtggcgatggcggtgttcgaccggctgatgccgggcaagaaccagctcgacgagttg
cgcgaggacgtcgatttcggccaggccgagctgttggaggtgccgcagggcacccgcacc
gaagccggcttccgggagaatatccgggtcggcgtgcgctacatcgaggcgtggctgagc
ggcaagggcgcggtgccgctctacaatctgatggaggatgccgccaccgccgagatcgcc
cgcgcccagatctggcagtgggtcaagtacggcgccaagctcgacgacggcacccagatc
acgcccgcgctgttcgagaccgtgctgcacgaggagatggcacggctgcgccaggagatc
ggcgcggaggcgttcgactacggccgcttcgccgaggcaacccagctgttccacaagctg
tcgctggcggcggagttcgaggcgttcctcaccatcccggcctatgccctgatcgactga

DBGET integrated database retrieval system