KEGG   Barnesiella viscericola: BARVI_11310Help
Entry
BARVI_11310       CDS       T02986                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bvs  Barnesiella viscericola
Brite
KEGG Orthology (KO) [BR:bvs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BARVI_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHF13236
UniProt: W0EW00
Position
2647848..2648864
Genome map
AA seq 338 aa AA seqDB search
MELLIIIIVLALLFDFINGFHDAANSIATIVSTKVLTPFQAVLWAAVFNFVAFFIAKYII
GGFGIANTVSKTVVEEFITLPIILSGIIAAIIWNLFTWWKGIPSSSSHTLIGGFAGAAIM
ASGFGAIQLNIILKIAAFIFLAPFIGMVVAFGFTILVLYICRRAQPHRAEMWFKRLQLVS
SAMFSIGHGLNDSQKVMGIIAAALIAAHSMGLGAGINSIADLPDWVAFACFTAISLGTMS
GGWKIVKTMGTKITKVTPLEGVVAETAGAFTLYLTEFLKIPVSTTHTITGAIIGVGATKR
LSAVRWGVTKDLWVAWILTIPVSALLAAGIYGLVSLFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagttactcataattatcattgtcctggcgctgctgttcgattttatcaacggcttt
cacgatgcagccaattcgattgcaaccattgtgtcgaccaaggtgctcaccccctttcag
gcggtcttgtgggctgcggtctttaactttgtcgccttcttcattgccaagtatatcatt
ggtggcttcggcattgccaacaccgtctccaagacggtggtcgaggagtttatcacgctg
cccatcatcttgtcgggaatcattgccgccatcatctggaacctcttcacgtggtggaag
ggaatcccctcgtcctcgtcgcacacgcttatcggcgggtttgccggggcggccatcatg
gcaagcggtttcggcgcgatacagctcaatatcattctcaaaatagccgccttcatcttt
ctggcaccgttcatcggtatggtggtagccttcggcttcacgatactggtgctctatatc
tgccgacgggcacagccgcacagggccgagatgtggttcaagcggttgcagctggtatcg
tcggcgatgttcagcataggccacggcctgaacgactcgcagaaggtgatgggtatcatc
gccgccgcgctcattgccgcccactccatggggctgggagccggtatcaacagcattgcc
gacctgcccgactgggtagcctttgcctgcttcacggccatctcgctgggcacgatgtcg
ggcggttggaagattgtcaagacgatgggtacgaagattaccaaggtgactccgctcgaa
ggcgttgtggccgagacggcgggagcctttaccctctatctgaccgagttcctgaaaatc
ccggtgagtaccacccacaccattacgggtgccatcatcggcgtgggagccaccaaacgg
ttgtcggccgtgcgctggggcgtgacgaaagacctgtgggtggcctggattctcaccata
ccggtgagtgccctgttggccgccggtatctatggcctggtttccctctttctgtga

DBGET integrated database retrieval system