KEGG   Phocaeicola vulgatus: BVU_2880
Entry
BVU_2880          CDS       T00546                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
bvu  Phocaeicola vulgatus
Pathway
bvu00620  Pyruvate metabolism
bvu00640  Propanoate metabolism
bvu00650  Butanoate metabolism
bvu01100  Metabolic pathways
bvu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVU_2880
   00640 Propanoate metabolism
    BVU_2880
   00650 Butanoate metabolism
    BVU_2880
Enzymes [BR:bvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     BVU_2880
SSDB
Motif
Pfam: PFL-like Gly_radical Coatomer_WDAD
Other DBs
NCBI-ProteinID: ABR40522
UniProt: A6L4A8
Position
complement(3644616..3646844)
AA seq 742 aa
MEMNKVFKDGLWSKEINVSDFVYTNITPYEGDASFLAGPTERTKKVWNECLKALEEERAN
NGVRSLDNVTVSTITSHKAGYIDRENELIVGLQTDELLRRAIKPYGGIKVVEKACHENGV
EVDEKVKDIFTHYRKTHNDGVFDAYTEEIRSFRSLGFLTGLPDNYARGRIIGDYRRLALY
GIDRLIEAKQEDLRNITSPMTDARIRLREEVAEQIKALKEIKILGEYYGLDLSRPATNAQ
EAVQWVYMAYLAAVKEQDGAAMSLGNVSSFLDIYIQYDLDHGKIDESFAQELVDQFIIKL
RMVRHLRMQSYNDIFAGDPTWVTESIGGRFNDGRTKVTKTSFRFLQTLYNLGPSPEPNMT
VLWSPELPEGFKEFCAQVSIDTSSIQYENDTLMREVRNCDDYGIACCVSYQAIGKQIQFF
GARCNLAKALLLAINGGRCENTGTVMVKDIPVLTGDLLNFEEVWSNYKKVLMQIARVYND
AMNIIHYMHDKYYYEKAQMAFIDTDPRINLAYGVAGLSIAIDSLSAIKYGKVRAKRNDIG
LTEGFDIENTYPCFGNDDDRVDHLGVDLVYFFSEELKKHPVYKNARPTLSLLTITSNVMY
GKKTGATPDGRAKGVAFAPGANPMHGRDKNGAIASLSSVAKLRYRDAQDGISNTFSIVPK
SLGVDRETRIENLITMMDGYFTKGAHHLNVNVLNREMLEDAMEHPEKYPQLTIRVSGYAV
NFIKLSREHQLEVISRSFHERM
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaaatgaacaaagtttttaaggatggattgtggagtaaggaaattaatgtttcagac
ttcgtatataccaacattaccccttatgagggcgatgcctcattcttggcaggccccaca
gagcgaactaaaaaagtgtggaacgaatgcctcaaggcactagaagaagaacgtgccaat
aacggagttcgttcccttgataatgtaacagtatctactatcacctcacataaagcagga
tacattgaccgtgaaaacgaactgattgtaggtcttcagacggacgaacttctgcgccgt
gccatcaaaccttacggtggtatcaaggtcgtagaaaaagcctgccatgaaaacggtgtg
gaagtagatgaaaaagtaaaggatatctttactcattatcgcaaaacccataatgatggc
gtatttgatgcttataccgaagaaatccgctctttccgttcactcggtttcctgaccggt
ctgcccgataactatgcacgcggacgcattattggtgactaccgccgtttggcactgtat
ggtatcgaccgactgattgaagcaaaacaagaagatttgcgcaatatcaccagtccgatg
accgatgcccgtatccgcctgcgcgaagaagtagccgaacaaattaaagcactgaaagaa
ataaaaatattgggtgaatattacggactcgatttgagccgtcccgctactaatgcacaa
gaagcggttcagtgggtttatatggcatatcttgctgccgtgaaagaacaagatggagca
gctatgtcattgggcaacgtttcttcattcctggatatctatattcaatatgatttggat
catggtaaaattgacgagtcattcgctcaggagctagtggatcagtttatcatcaagtta
cgtatggtccgccatctgcgtatgcaatcatacaatgacatctttgcaggtgaccccact
tgggtgaccgaatctatcggcggacgattcaacgacggacgcaccaaagtaacaaaaact
tctttccgcttcttacaaacactatacaatctgggtccgtcacctgaacccaatatgact
gtactgtggagtccggagttgccggaaggtttcaaagaattctgcgcacaggtttctatc
gacacttcttccatacagtacgaaaacgatacgctgatgcgcgaagtgcgtaactgtgac
gattatggcattgcctgctgtgtgtcttatcaggctatcggcaaacaaatccaattcttc
ggggcacgctgtaatctggctaaggctctgttactagctatcaatggcggacgttgcgaa
aatacaggaactgtaatggtgaaagatattcctgtattgacaggagacttgctgaacttt
gaagaagtatggtctaattataagaaagtattaatgcagattgcacgtgtgtataatgat
gcgatgaatatcattcactatatgcatgacaaatattattacgaaaaggctcaaatggca
ttcattgataccgatccacgtatcaatctggcatatggcgtagccggtctgtccattgcc
attgactcattgtctgccatcaaatacggcaaggtacgtgccaaacgtaatgatataggt
ttgactgaaggctttgatattgaaaatacatatccttgcttcggtaatgatgatgaccgc
gtagaccacttaggagtagatttggtttatttcttcagtgaagaattaaagaaacatccg
gtatacaaaaacgcccgtcctaccctgtcactgctgactatcacctccaatgtaatgtac
ggtaagaaaacaggtgccactcctgacggtcgtgccaaaggggttgctttcgctccgggt
gccaacccgatgcacggacgtgataagaacggtgccatcgcctcattgagttctgtagcc
aaactacgctatcgtgatgctcaggacggcatcagtaacacattctctatcgtaccaaaa
tcactaggagtggatcgggaaacccgcatagagaatctgataaccatgatggacggttat
ttcaccaaaggggcacaccacctgaatgtaaatgtgctgaaccgtgaaatgctggaagat
gcaatggagcatcctgaaaaatacccgcaacttactatccgcgtatcaggttatgccgta
aatttcatcaaattgagccgtgaacatcagctggaagtaatcagccgttctttccacgaa
agaatgtaa

DBGET integrated database retrieval system