KEGG   Bacteroides vulgatus: BVU_0466Help
Entry
BVU_0466          CDS       T00546                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00010  Glycolysis / Gluconeogenesis
bvu00051  Fructose and mannose metabolism
bvu00562  Inositol phosphate metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
bvu01130  Biosynthesis of antibiotics
bvu01200  Carbon metabolism
bvu01230  Biosynthesis of amino acids
Module
bvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bvu_M00002  Glycolysis, core module involving three-carbon compounds
bvu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_0466
   00051 Fructose and mannose metabolism
    BVU_0466
   00562 Inositol phosphate metabolism
    BVU_0466
Enzymes [BR:bvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BVU_0466
Exosome [BR:bvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BVU_0466
  Exosomal proteins of bladder cancer cells
   BVU_0466
  Exosomal proteins of melanoma cells
   BVU_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Latrotoxin_C
Motif
Other DBs
NCBI-ProteinID: ABR38176
UniProt: A6KXL2
Position
complement(656295..657050)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKNLQEGIALAKELNEALAADKPNCDVVICTPFIHLASVTPIVDKAVI
GVGAENCADKVSGAYTGEVSAEMVASTGAEYVILGHSERRAYYHETVEILEEKVKLALAN
NLKPIFCIGEVLEEREANKQNEVVAAQLASVFSLSAEDFSKIILAYEPVWAIGTGKTATA
EQAQEIHAFIRSLIADKYGKEVADNTSILYGGSCKPSNAKELFANPDVDGGLIGGAALKV
VDFKGIIDAFK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaagaaccttcaggaaggtatt
gctctggcaaaagaattgaatgaagctttggctgctgacaaacctaattgtgatgtggta
atctgtactccgtttattcacttggcttctgttactcctattgttgacaaggctgtaatt
ggtgtaggtgcagaaaactgtgcagataaagtatcaggtgcatataccggtgaggtttct
gctgaaatggtagcttctacaggtgctgaatatgtaattctgggtcactcggaacgtcgt
gcttactatcacgaaactgtggaaatcctggaagaaaaagttaaattggctttggctaat
aacttgaagcctatcttctgcatcggtgaggtattggaagagcgtgaagctaacaaacaa
aatgaagtggttgctgctcagttggcatcggtattctctttgtctgccgaagattttagt
aagattatcttggcttacgaaccggtttgggctattggtacaggtaagactgctactgct
gaacaggctcaggaaatccacgcgtttatccgttctttgattgccgacaagtatggtaaa
gaagttgctgataatacttcaatcctttatggtggaagctgcaagccttctaatgctaaa
gaattgtttgctaaccctgacgtagacggtggcttgattggtggtgctgctttgaaagtt
gttgacttcaaaggcattatcgatgcattcaaataa

DBGET integrated database retrieval system