KEGG   Bacteroides vulgatus: BVU_0621Help
Entry
BVU_0621          CDS       T00546                                 

Definition
(GenBank) putative endonuclease/exonuclease/phosphatase family protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 LPAM_1
Motif
Other DBs
NCBI-ProteinID: ABR38329
UniProt: A6KY15
Structure
PDB: 

Position
complement(893309..894154)
Genome map
AA seq 281 aa AA seqDB search
MKQILFLLAAVLLLGGCAEEKKTDVRWATFNIRYDNPQDSLNNWQYRKDRVCQFIKDHEL
DIVGMQEVLHNQFQDLRAGLPEYDGIGVGRDDGKTAGEYAPLFYRKDKYEVLDSNTFWLA
ENPDSVGMMGWDAVCVRIATWAKFKDKATGKIFMAVNTHFDHVGEEARRQSALLIIRKIK
EIVGERPAVVTGDFNVTDASDAYETITTNEFVMKDAYKTAARVTGVDYTFHDFARIPAED
CEKIDFIFVTPQVLVKSCEIPAEVPEALLSDHNPQLADLEF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaattctatttttattggcagccgtcctgttattgggcggctgtgcggaagag
aagaagaccgacgttcgttgggctacttttaatatccgttacgacaatccgcaggacagt
ttgaacaattggcaatatcggaaagaccgtgtgtgccagtttattaaggaccatgagctg
gatattgtcggtatgcaggaagtcttgcataaccagtttcaggatcttcgcgcaggcttg
cccgaatacgatggtatcggtgtgggacgtgatgacgggaagacagcaggtgaatatgcg
ccgcttttctatcgtaaggacaaatatgaggtgttggactccaatactttctggttggcc
gaaaatcccgatagcgtaggaatgatgggatgggatgcggtttgtgtccgtatcgccact
tgggcaaaatttaaggacaaggctaccggaaagatattcatggctgtcaatactcatttt
gaccatgtgggtgaagaggcccgccgtcaaagcgcattgctcattatccgtaagataaaa
gagatcgtaggcgaacgtcccgcagtggttacgggcgactttaatgtgaccgatgcgagc
gatgcatacgaaacaatcaccaccaacgagtttgtgatgaaggatgcttataagacggct
gcccgtgtgaccggcgttgattatacttttcatgattttgcccgtatcccggccgaggat
tgtgaaaagattgatttcatctttgtcactccgcaagttctggtgaagagttgtgaaata
ccggctgaagtaccggaagctttactttccgaccataatcctcagttggctgacttggaa
ttctga

DBGET integrated database retrieval system