KEGG   Bacteroides vulgatus: BVU_1040Help
Entry
BVU_1040          CDS       T00546                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00010  Glycolysis / Gluconeogenesis
bvu00030  Pentose phosphate pathway
bvu00051  Fructose and mannose metabolism
bvu00052  Galactose metabolism
bvu00680  Methane metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
bvu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVU_1040
   00030 Pentose phosphate pathway
    BVU_1040
   00051 Fructose and mannose metabolism
    BVU_1040
   00052 Galactose metabolism
    BVU_1040
  Energy metabolism
   00680 Methane metabolism
    BVU_1040
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BVU_1040
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BVU_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABR38733
UniProt: A6KZ69
Position
1380224..1381234
Genome map
AA seq 336 aa AA seqDB search
MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVYGIHSGFRGLLDNDVEPLTEKSLSGL
LNLGGTILGTSREKPFKKRLSAASEDKPALMLKNIHDLGLDCIVCIGGNGTQKTAAKLAQ
AGVNVVSVPKTIDNDVWGTDVSFGFDSAVTIATDAIDRLHSTASSHQRVMVIEVMGHKAG
WIALYSGMAGGGDVILIPELSYDIHNIGNTIIERLKKGKPYSIVVVAEGIKTMDGKKAAE
YIAQEIEYETGFETRETVLGYIQRGGSPTPYDRNLATRMGGHATELIASGQFGRMVSLQG
AEIGSIPLNEVAGKLKLVNENHDLIVQGKRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagataggaatattgacatcaggaggagactgtccaggaataaacgccacaattaga
ggagtttgcaaaacagcgataaatcattacggtatggaagtttatggaattcatagcgga
ttccggggattgctggacaatgacgtagaaccattgacagaaaaatcattatcgggcttg
ttaaatctgggagggacaatactaggcacttccagagaaaagccattcaagaaacgcctg
tcggcagcctcggaggacaaaccggctttgatgttaaagaatatccatgatctaggtctg
gactgtatcgtatgtatcggcggaaacggaacccaaaagaccgcagccaaactggcccaa
gcaggtgtgaacgttgtttctgtacctaaaacaatagataacgatgtttggggaacagac
gtttcattcggattcgattctgccgtgaccattgctaccgatgccattgaccggctgcat
tctacagccagttcacaccaacgtgtcatggttattgaagtgatgggacataaagctggc
tggattgcactttattccggaatggcgggaggcggtgacgtgattcttattccggaactg
tcttatgatattcataatataggcaataccatcattgaacgcttgaaaaaagggaagccc
tattccattgttgttgtcgcagaaggcatcaaaaccatggacggcaaaaaagccgccgaa
tatatagcccaagaaatagaatatgaaaccggattcgagacccgtgaaactgtactggga
tatatccagcgtggcggctctcctactccctacgaccgtaatctggccactcgtatgggt
ggacatgccacagaactgattgcttccggacaattcggacgaatggtctctctgcaaggt
gcggaaattggctccatccctctgaatgaagtggctggtaaattaaaacttgtcaatgag
aaccatgacctgattgtacaaggcaaacggatgggaatctgcttcggataa

DBGET integrated database retrieval system