KEGG   Bacteroides vulgatus: BVU_1187Help
Entry
BVU_1187          CDS       T00546                                 

Definition
(GenBank) possible uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00860  Porphyrin and chlorophyll metabolism
bvu01100  Metabolic pathways
bvu01110  Biosynthesis of secondary metabolites
bvu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BVU_1187
Enzymes [BR:bvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BVU_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABR38878
UniProt: A6KZL4
Position
1602256..1603005
Genome map
AA seq 249 aa AA seqDB search
MKIKKVLVSQPKPTSEKSPYYDIAEKYGVKIDFRPFIKVESLSAKEFRQQKVSILDHTAV
IFTSRHAIDHFFNLCTELRVTVPETMKYFCTSETIALYIQKYVQYRKRKVFFGATGKFAD
LVPSIVKHNTEKYLVPMSDVHNDEIKTLLDKNKIQHTEVVMYRTVSNDFTPEEEFDYDML
LFFSPAGINSLMKNFPEFDQKEIAIGCFGPATAKAVKDAGLRLDLEAPTVEAPSMTAALD
MFIRERNKD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataaaaaaagtcctcgtatctcagccgaagccgacttctgaaaagtcgccatac
tatgatattgctgagaagtacggtgtgaaaattgatttccgcccgttcatcaaagttgag
agcttgtcggcaaaagagttcagacagcaaaaagtctctattcttgatcataccgctgtg
atttttacatcgcggcacgctatcgaccatttcttcaatctgtgtacagaattgcgtgtt
actgtgcccgaaacaatgaaatatttctgtacgtccgaaaccattgctttgtacattcag
aaatatgttcagtatcgtaagcgtaaagtgttcttcggcgcgaccggtaaattcgcagat
ttggtgccttctatcgtaaagcacaacacggaaaaatatttggtgccgatgtctgatgta
cacaatgatgagatcaagactttattggataaaaataaaattcagcatacggaggtagtg
atgtatcgtacggtaagtaatgatttcactcctgaagaagagttcgattacgatatgctg
ttgtttttcagtcctgcaggaatcaattctttaatgaagaattttccggagttcgaccaa
aaggaaattgcgataggatgttttggtcctgctactgctaaagcggtaaaggatgccgga
ttgcggttggatctggaagctcctactgtagaggctccgtccatgactgcggcattggat
atgtttatccgcgagcgtaataaggattaa

DBGET integrated database retrieval system