KEGG   Bacteroides vulgatus: BVU_1663Help
Entry
BVU_1663          CDS       T00546                                 

Definition
(GenBank) glycoside hydrolase family 32, candidate levanase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BVU_1663
Enzymes [BR:bvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     BVU_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4980
Motif
Other DBs
NCBI-ProteinID: ABR39344
UniProt: A6L0Y0
Position
2148324..2150300
Genome map
AA seq 658 aa AA seqDB search
MKQMFQPVRQVSVNFADNEKQSNKTFNILYFMKTNLVNLALGLAFTGGAVSCQSQKNDLV
FEHQGDTVTIVHIVRPAKYLLLPIQESSKEGLVRLDTGSPADTDMDVRLATDSVEYYVPF
ALPQGSEEATVIIKKVEADALCWDSIRVSDTFDTANRDKFRPVYHHTPLYGWMNDANGLV
YKDGEYHLYFQYNPYGSVWGNMHWGHSVSKDLVHWEHLDPAIARDTLGHIFSGSAIVDKH
NSAGYGENTIVAFYTSHRNIPSGQSQVQSMAYSTDNGRTYTKYEQNPVLTPFDGLQNFRD
PKVFWYEPEQKWIMIVSADKNMRFYSSANLKQWEYMSEFGEGFGPQPNQFECPDFIQLPV
DGDRTRMKWVMIVNINPGFVYGGSGTMYFTGDFDGHQFVCDTKPEVVKWLDWGKDHYATV
CFSNTGDRVIAVPWMSNWQYANYTPIQQFRSANALPRELSLYTGEDKQLYLSAAPVKETE
HLRKDSKKLDDFTVNGEKRLETLFENNDGAFELELQLVSAGKEAGFELLNSLGEKVKIYL
DASEGRVVMDRAESGIVDFGKKVKPHDLDTEESYARYKEVTVNYKNDFALGTWAPINTAK
AHKIQVFVDNGSVELFVDGGRVAMTNLVFPNEPYNSLRFYSKGGEMKISNFTIYKLGL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgtttcagccggtaaggcaggtttccgttaactttgccgataacgaaaaa
caatcaaacaaaacttttaatatcctatacttcatgaaaacaaatcttgttaaccttgca
ttaggtttagcctttacaggaggcgctgtttcttgtcagtcacaaaaaaatgacctggtt
ttcgaacatcagggagatacggtgacaatcgtacatattgtccgtcccgctaaatatttg
ttgcttccgattcaggagagcagcaaggaaggactggtaaggctggatactgggagcccc
gcagataccgatatggatgtgcgtctggctacagacagcgttgaatattatgttccgttt
gccttgcctcagggaagtgaggaagctactgtcattataaagaaggtggaggcagatgcg
ctgtgttgggacagcatccgggtttcggatacatttgatacggcaaacagggataagttc
cgtccggtttatcatcacactccgctttatggctggatgaatgatgccaacggactggtt
tataaagacggtgaatatcacctttattttcaatataatccatacggctccgtatgggga
aatatgcactggggacattccgtgagcaaggatttggttcattgggagcatcttgaccca
gcgattgcccgtgatacattggggcatatcttttcgggaagtgccattgtggataaacat
aacagcgcaggctacggtgaaaatacaattgtcgctttttatacttcgcaccgtaatata
cccagtgggcagagccaggtgcaaagtatggcatacagtacggacaacgggcgtacttat
acgaagtatgaacagaatccggttcttactccgtttgacggactacagaatttccgtgac
ccgaaggtcttttggtatgaacccgaacagaaatggattatgattgtcagtgcggataag
aatatgcgtttttattcatctgccaacttgaagcaatgggaatacatgagtgagtttgga
gaaggatttggccctcagcccaatcagttcgaatgtccggatttcatccaactgcctgta
gatggtgaccggaccaggatgaaatgggtgatgattgtcaatatcaatccgggatttgtc
tatggaggcagcggtacgatgtattttacaggcgactttgacgggcatcagtttgtatgt
gatacgaaacccgaggtggtgaaatggctcgactggggaaaagaccattatgccactgtt
tgtttctcgaataccggcgaccgtgtcattgccgtaccttggatgagcaactggcagtat
gctaactatactcctatacaacagttccgcagtgccaatgctttgccgcgtgagctgagt
ctgtatacgggagaagacaaacagctttatctgagtgccgcaccggtaaaggaaacggag
cacttgcggaaagattctaaaaagctggatgattttacagtaaatggcgagaagcgttta
gaaacactttttgaaaataacgacggcgcttttgaactggaattgcaactggtgtcggct
ggtaaagaggctggttttgaattgctgaacagtttgggtgagaaggtgaagatttatttg
gacgcttcggagggacgtgtggtaatggaccgtgcggaaagtggtattgtagattttggc
aagaaggtaaaaccgcatgatttggataccgaagaaagttatgctcgttataaagaggtt
acggtgaattataaaaatgattttgctttgggtacttgggctccgataaacaccgcgaag
gcacataaaattcaagtttttgtggataatggaagtgtggagttgtttgttgacggtggc
cgcgttgccatgactaatctggtattcccgaatgaaccttataactctttgcgtttttat
agtaaaggaggagagatgaagatttcaaatttcacaatatataagttaggtttgtaa

DBGET integrated database retrieval system