KEGG   Bacteroides vulgatus: BVU_2661Help
Entry
BVU_2661          CDS       T00546                                 

Definition
(GenBank) putative aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00360  Phenylalanine metabolism
bvu00362  Benzoate degradation
bvu01100  Metabolic pathways
bvu01120  Microbial metabolism in diverse environments
bvu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BVU_2661
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BVU_2661
   00622 Xylene degradation
    BVU_2661
   00621 Dioxin degradation
    BVU_2661
Enzymes [BR:bvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BVU_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ABR40313
UniProt: A6L3P9
Structure
PDB: 

Position
complement(3378964..3380496)
Genome map
AA seq 510 aa AA seqDB search
MKILDCTLRDGGYYTNWDFNSKIVDAYILAMNELPIDYLEVGYRNKPSKEYMGKFGYTPV
SVLKHLRNISTKKIAIMLNEKNTTPEDLNHLLLPIIGLVDMIRIAIDPQNIDRAIVLAKA
IKTMGFEVGFNVMYMSKWAEMNGFLSKLKAIDKIADLFCMVDSFGGITPKEVKNLLKEVR
KYTHVPVGFHGHDNLQLGLINSITAIDDGIDFIDATITGMGRGAGNLKMELLLTYLNKHH
GLNVDFNVLGNIITTFTPLLEKYQWGTNLPYMLSGANNIPQKEVMDWVTNRVYSFNSIIR
ALDNRKNKMEDNAKYPLLNIKNKFDRVVIIGGGFNAIEHKEAIKSFIETHTNTAIIFATA
RYAREYLDVNAPHFYCLVGNEGHRLTHNINPQNLSGICVLPPYPRPMGTEVPEYAKNVTF
ELENITFIDQYKDSVTTIALQLAILLTDQDIYLVGYDGYPGNVLSEKEMALTNENRTIFA
TYTTISGKILKSLTPSIYKEIEVVSVYQFI
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattagattgtactcttcgtgatggtggatattacaccaattgggattttaac
tcaaaaattgtcgacgcttatatactagccatgaacgaacttcctattgactatttggaa
gttggttatagaaataaaccaagtaaagagtatatgggaaaatttggatatactcctgta
tctgttttaaaacatttaaggaatatatccacaaaaaaaatagcaataatgctaaatgaa
aaaaacacgacccctgaagatctcaatcatttacttctgcccataataggattggtagac
atgatacgtattgccattgatcctcaaaatatagaccgtgcaatagttctagcaaaagct
ataaaaacaatgggatttgaagttggttttaatgtaatgtatatgtcaaaatgggcagaa
atgaatggatttttgtctaaattgaaggctattgacaaaattgctgatttattttgtatg
gtcgattcttttggaggtatcacacctaaagaagtgaaaaatctacttaaagaagtacgt
aaatatactcatgttcccgttggattccacggacacgacaacctacaattaggattgatt
aactctattaccgcaatagatgatggcatagactttatagacgcaaccattacaggtatg
ggacgtggtgcaggtaacctaaagatggaattattacttacatatcttaacaaacatcat
ggattaaatgttgatttcaatgtgcttggaaatataataaccacttttactccattactt
gaaaaatatcaatggggaacaaatctgccatacatgctttctggagcaaataatattcca
caaaaagaagttatggattgggtaacaaatcgtgtttattcatttaatagtattatacga
gcgcttgataacagaaaaaataaaatggaggataatgccaaatatcctttacttaatata
aagaacaaatttgatagagtagtaattattggtggtggatttaatgcgatagaacataaa
gaagctatcaagtctttcattgaaacacatactaatacagctattatttttgccacagct
cgatatgcacgagaatatcttgatgtaaatgcacctcatttttattgtcttgttggtaac
gaagggcatagattgacacataatataaatccccaaaatctttcaggaatatgtgtatta
ccgccatatccgcgtcctatgggtacagaagttcccgagtatgccaaaaatgttacattt
gaactcgaaaacataactttcattgatcaatacaaagattctgtaacaacaatagcatta
caattagcaattttacttactgatcaagacatttatcttgttggctatgacggatatccg
gggaatgtactttctgaaaaagaaatggcactaacaaatgaaaacagaactatatttgct
acatataccaccattagtggaaaaatactaaaatcacttactccgtctatatacaaagaa
attgaagtcgtgtctgtataccagtttatataa

DBGET integrated database retrieval system