KEGG   Bacteroides vulgatus: BVU_2787Help
Entry
BVU_2787          CDS       T00546                                 

Definition
(GenBank) putative molybdenum transport ATP-binding protein
  KO
K05776  molybdate transport system ATP-binding protein
Organism
bvu  Bacteroides vulgatus
Pathway
bvu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BVU_2787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvu02000]
    BVU_2787
Transporters [BR:bvu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    BVU_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_23 RsgA_GTPase MMR_HSR1 DUF87 FtsK_SpoIIIE DUF1408 Mg_chelatase Dynactin
Motif
Other DBs
NCBI-ProteinID: ABR40433
UniProt: A6L419
Position
3555155..3556603
Genome map
AA seq 482 aa AA seqDB search
MQNIIAIENGVTRHPLYRMKEPVNMTLAAGEHIAVVGRNGAGKSILVDTITGRWPLLMNE
VKYDFSPSPSKMAYENIKYIAFRDSYGDSDGNYYYQQRWNAHDLDETPLVRDLLPEATDS
GLKKALYELFGIERMLDKHIILLSSGELRKFQLTKTLLSNPRVLIMDNPFIGLDAKTRDL
LHTLLGELTKVTHLQVILILSKSDDIPAFITHVIPVEDRVCGKKITLQEYLAVRKPIPER
ILSEEKEARILNLPYGGDLYHTEHVVDLNKVSIRYGERTILKDLDWTVKCGEKWALSGEN
GSGKSTLLSLVCADNPQSYACDITLFGRKRGSGESIWEIKKHIGYVSPEMHRAYLKNLPA
IDIVASGLHDSVGLYKRPRPEQMAACEWWMDIFGIADLKDRNFLQLSSGEQRLVLLARAF
VKDPELLILDEPLHGLDLYNRQLVKDVIETFCRRKDKTMIMVTHYQEELPACITNFLFLK
RN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatattattgcgatagaaaatggtgtgacccgccatccgctgtaccggatgaag
gaaccggtgaatatgacacttgccgccggagaacatatagctgttgtggggagaaacggg
gcaggaaaaagtatattggtagatacgattacaggccggtggccgttgttgatgaacgaa
gtgaagtatgatttctctccttctccttcgaagatggcatacgagaatataaagtatatt
gctttccgtgattcatacggagattccgatggaaattactattatcagcaacgatggaat
gcccatgatttggatgaaaccccactggtacgtgatttgttgcccgaagcgaccgattca
ggtctgaaaaaggctttgtatgaactgtttggcatagagaggatgctggataaacatatt
attctgctttccagtggtgagttacgtaagtttcaactgacaaagactttgctgagtaat
ccgcgtgtactgattatggataatccctttatcggactggatgcgaagacgagggacctg
cttcatacattgttgggcgaactgactaaagtaacccatttgcaggtaatccttatcttg
tctaagtccgatgatattcctgcttttattactcatgttattcctgtggaagacagggtg
tgtggtaaaaagataactttgcaggaatatttggcggtccgtaagccgataccggaacgg
atactttccgaagaaaaggaggcacggattctgaatttgccttacggcggtgatttgtat
cacaccgagcacgtagtcgatttgaacaaggtaagcatccgttatggcgagcgtaccatt
ttgaaagatttggactggacagtgaaatgtggcgagaaatgggctttgagtggagagaac
ggttcaggaaagtctacgttgttgagtttggtctgtgcggataatccgcagagttatgct
tgtgatattaccttgttcggcagaaaacgcggttccggagaaagtatttgggagataaag
aagcatataggatatgtcagtcctgagatgcatcgcgcttatctgaaaaaccttcctgcc
atagatattgtggcaagcggactacatgattctgtggggttgtacaaacgtccgcgtccc
gagcagatggcggcttgtgaatggtggatggatatttttggtattgcagatttgaaagac
cggaatttcttgcagttgtccagtggcgagcagcgtctggtgttgttggcccgtgctttt
gtgaaggatcctgagttgcttattttggatgagcctttgcatgggttggacttgtacaac
cgccagttggtgaaagatgtgatagaaactttctgtcgtcgtaaggacaagaccatgatt
atggtgacacattatcaggaagagttgcccgcatgtataactaactttcttttcttgaag
cggaattaa

DBGET integrated database retrieval system