KEGG   Bacteroides vulgatus: BVU_2791Help
Entry
BVU_2791          CDS       T00546                                 

Definition
(GenBank) anaerobic C4-dicarboxylate transporter dcuB
  KO
K07791  anaerobic C4-dicarboxylate transporter DcuA
Organism
bvu  Bacteroides vulgatus
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvu02000]
    BVU_2791
Transporters [BR:bvu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BVU_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuA_DcuB DUF962
Motif
Other DBs
NCBI-ProteinID: ABR40437
UniProt: A6L423
Position
3560546..3561844
Genome map
AA seq 432 aa AA seqDB search
MLLQLLFVLVAIIVGARLGGIGLGVMGGVGLAILTFVFGLQPTAPPIDVMLMIVAVISAA
SCMQAAGGLDYMVKLAERLLRRNPSQVTILSPLVTYLFTFVAGTGHVAYSVLPVIAEVAT
ETKIRPERPLGIAVIASQQAITASPISAATVALLGLLTGFDITLFDILKITIPATLIGVL
VGAFLSKKVGKELLEDPEYLRRLEAGMIDTKHVELNDVKNMFHARISVIIFIAATLLIVL
FGSIPVMRPVFNGTALDMPAIIEILMLCAAAVILLISRTDGIKATQGSVFPAGMQAVIAI
FGIAWMGDTFINGNITELTGSIEGIVRQMPWLFGLALFVMSILLYSQAATVRAIVPLGIA
LGISPMMLIALFPAVNGYFFIPNYPTVVAAINFDRTGTTGIGKWILNHSFMMPGMVATIV
SIVVGLLLVQVF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaactgctatttgtacttgtcgctattattgtaggtgcccgtctgggaggt
atcggactgggagtgatgggaggtgtgggccttgccatattgacctttgttttcggactt
caacctaccgctccccctattgatgtgatgttgatgattgtcgccgttatctctgccgcc
tcttgtatgcaggctgccggcggactggactatatggtgaaattagcagaacggttgttg
cgtcgtaacccttcacaagtgactatcctgagtccgttggttacttatctgtttactttt
gtcgcaggtacggggcatgtggcctactctgtgcttcctgtcatagccgaggtggctacg
gaaactaaaattcgtcctgagcgtcctttaggcattgccgttatcgcctcgcaacaggct
attactgccagccctatctctgccgctaccgtagcgttgctgggattgctgacaggattt
gacatcactctgtttgatattctgaagattactattcccgctacattaatcggtgtgctg
gtgggagctttcctttcaaagaaggtgggtaaagagttgttggaagatcccgaatacttg
cgccgcttggaagccgggatgattgatacaaaacatgtggagctgaacgatgtgaagaat
atgtttcatgcccgtatctcggtgataatttttattgccgccacgctgttgatagtgttg
ttcggttctattcctgtcatgcgtcctgtgttcaatggtacggctttggatatgccggct
attattgagattttgatgttgtgtgcggcggctgttattcttctcatttcacgtacggat
ggaattaaagctacacaaggcagtgtgtttcctgccgggatgcaggcggtaatcgctata
tttggtattgcatggatgggagataccttcattaatggaaacattacggaactgacaggc
tctattgaggggattgtgcgccaaatgccctggttgttcggtctggcattgtttgtcatg
tccattttgctttatagccaggctgctacggtgcgtgccattgtgccgttagggatagca
ctgggtatttctccgatgatgttgattgctttgttccctgctgtcaacggatatttcttt
attcctaattatcctacagtggtggcagctataaattttgaccgtacaggaacaacaggc
attggaaaatggattctgaatcattcgttcatgatgcctgggatggtggccaccattgtt
tctattgtggtaggcctgctgctggtacaggtgttctag

DBGET integrated database retrieval system