KEGG   Bacteroides vulgatus: BVU_2799Help
Entry
BVU_2799          CDS       T00546                                 

Definition
(GenBank) cytochrome D ubiquinol oxidase subunit I
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00190  Oxidative phosphorylation
bvu01100  Metabolic pathways
bvu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVU_2799
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BVU_2799
Enzymes [BR:bvu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     BVU_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I ESSS
Motif
Other DBs
NCBI-ProteinID: ABR40445
UniProt: A6L431
Position
complement(3571150..3572652)
Genome map
AA seq 500 aa AA seqDB search
MFENIDTSLIDWSRAQFALTAMYHWLFVPLTLGLAVIMGLMETFYVTTGKEFWKNTAKFW
MKLFGINFAVGVATGLILEFEFGTNWSNYSWFVGDIFGAPLAIEGILAFFMEATFIAVMF
FGWNKVSKRFHLASTWLTGLGATISAWWILVANAWMQYPVGMAFNPETVRNEMVDFAAVA
LSPMAIAKFFHTVLSSWILGAVFVVGISCWYLLRNRQKEFALSSIKVAAAVGLFASLVTA
WTGDISGVQVAKVQPMKMAAAEGLHDGGNGVPFTIAGDLKIPKMLSILATHDIDGYVPGI
NNLLEGGYQMPDGTTALSAEEKIKRGQIAIAALDAFRKAHKAGDEASAAAARKTLDENVK
YFGYGYIKDPAHLVPNVGLTFWSFRIMVGLGGYFILFFIIVLIVSKKEKLADMRWLQRVA
LWTIPLAYIGSQAGWVVAEVGRQPWAIQDMLPVGAAISKLQTGSVQLTFFIFLLLFTVLL
FAEIGIMLKAIKKGPEGIKN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaacattgacacttcattaattgactggtcaagagcacagttcgctctaacg
gccatgtatcactggcttttcgtacctctcactttgggattggctgtgataatggggctc
atggagaccttttatgtaacaacaggtaaggaattctggaagaacacagctaaattctgg
atgaaactgtttggaatcaatttcgccgtaggtgttgccaccggtctgattctggaattc
gagttcggaactaactggagtaactattcctggtttgtgggcgatatcttcggagcccca
ctggctatcgaaggaatcctggcattttttatggaagccactttcattgccgtcatgttc
ttcggctggaacaaagtgagcaagcgtttccatctggcatccacctggctcaccggactg
ggagcaacgatctccgcttggtggattctggtcgccaatgcctggatgcaataccccgta
gggatggctttcaatcccgaaacagtaagaaatgaaatggtggactttgcagctgtcgcc
ctctctcccatggctatcgccaagttcttccacacagtgttaagcagctggatactggga
gccgtttttgtagtaggaataagttgctggtatttactgcgcaaccgtcagaaggagttc
gctctgagcagtattaaagttgccgccgccgtaggtctgttcgcctctctcgtcactgca
tggacgggggatatttcgggagtacaggtagccaaagtgcaacctatgaaaatggctgcc
gctgaaggattgcacgatggcggaaacggagtacccttcaccattgcaggcgatttgaaa
atccccaaaatgctttctatccttgccactcacgacatagacggttatgtaccgggtatc
aacaatctgctggaaggtggttatcagatgcccgacggtacaacggctttatcggccgaa
gagaaaattaaacgcggacagattgccatcgccgccctggatgcattccgcaaagcgcat
aaggcaggtgacgaagcaagtgccgcagcagctcgcaagacattggacgaaaacgtgaaa
tattttggttacggatatatcaaggatcctgcccatctggttcctaatgtaggacttact
ttctggtcattccggatcatggtggggctgggaggttatttcatcctgttctttattata
gtactgattgtatcgaaaaaagagaaactggctgatatgcgatggttgcaacgggtggct
ttgtggactattccactagcctatatcggcagtcaggcaggctgggtggtagccgaagtg
gggcgccagccatgggccatacaggatatgttgcctgtaggagcagccatctccaaattg
cagacaggttccgtacagcttactttctttatcttccttctattgtttaccgttctgctc
tttgctgaaataggtatcatgctgaaggccatcaagaaaggaccggaaggaattaagaat
taa

DBGET integrated database retrieval system