KEGG   Bacteroides vulgatus: BVU_2800Help
Entry
BVU_2800          CDS       T00546                                 

Definition
(GenBank) outer membrane efflux protein
  KO
K12340  outer membrane protein
Organism
bvu  Bacteroides vulgatus
Pathway
bvu01501  beta-Lactam resistance
bvu01503  Cationic antimicrobial peptide (CAMP) resistance
bvu02020  Two-component system
bvu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BVU_2800
  09132 Signal transduction
   02020 Two-component system
    BVU_2800
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    BVU_2800
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BVU_2800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvu02000]
    BVU_2800
   02044 Secretion system [BR:bvu02044]
    BVU_2800
   01504 Antimicrobial resistance genes [BR:bvu01504]
    BVU_2800
Transporters [BR:bvu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BVU_2800
Secretion system [BR:bvu02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter [MD:M00325]
   BVU_2800
  RTX toxin transporter [MD:M00326]
   BVU_2800
  RaxAB-RaxC type I secretion system protein [MD:M00339]
   BVU_2800
  AlgE-type Mannuronan C-5-Epimerase transporter [MD:M00571]
   BVU_2800
Antimicrobial resistance genes [BR:bvu01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    BVU_2800
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    BVU_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP Pox_F11 Arfaptin QIL1
Motif
Other DBs
NCBI-ProteinID: ABR40446
UniProt: A6L432
Position
3573048..3574391
Genome map
AA seq 447 aa AA seqDB search
MRQRVVYFVMIWVAVTSVSAQEAKKWTLDDCIDYALEKNIQLQQDKISLEESSVDVKTAK
AALFPSLSFSTGQNVTNRPYQETSNTVSGTEIISSDSKTTYNGNYGLNAQWTLWNGNKRL
NAIKQKKTGQQIAGLTVAETENSLQEQIAQIFIQILYADESVKINQNTLQVSQATYDRGK
ELFHKGSISKADLAQLESQVGSDKYQLVISESSLRDYKLQLKQLLELDGTEEMDLVLPEL
ADEHVLQPLPAQEDVYQQALASRPEIQSSKLSIENSKLDISVAKAGYLPTISLSASTGSM
TNSASDNSWSKQMKYGWNNMIGLNINIPIFDNRQNKSAVQKARLQYDSSLLDLINKQKEL
YKNIESLWLDATNAQEQYAAAESKLKSSQASYEMVSEQFNLGMKNTVELLTEKNNLLSAQ
QQRIQAKYMAILDRTLLNFYAGQDIKL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgagtagtatatttcgtaatgatttgggtcgcggtcacttcggtttccgcg
caagaggccaaaaagtggacgctggacgactgtattgactatgcattggagaaaaatatc
caattgcagcaggacaaaatctcactggaagagagttctgtagacgtgaaaaccgccaaa
gccgcactatttcccagtctgtcgttcagtacaggacagaatgtgacgaaccgtccgtat
caggaaaccagtaacacggtaagcggaacggaaatcatcagtagtgacagtaaaaccact
tataatggaaactatggtctgaatgcacaatggacattgtggaatggtaacaaacggttg
aatgccatcaaacaaaagaagacgggtcagcagattgcagggcttaccgtagccgaaaca
gaaaactctttgcaagagcagattgcacaaatattcatccagatactttatgccgacgag
tcggtgaaaattaaccagaacaccttacaggtgagccaagctacatacgacaggggcaaa
gaactctttcataaaggaagtatttcaaaagccgatttggcacaattggaatcacaggta
ggcagtgacaaatatcagttggtgatctccgaaagttccttgcgtgactataaattgcag
ttgaagcagttgttggagctggatggtacggaagaaatggatttggttcttcccgaactc
gccgatgaacatgttttgcaaccgttacctgctcaggaggatgtttatcagcaggctttg
gcatcacgtccggaaattcaaagcagcaagttgagcatagagaattccaaattggacata
tcagtggctaaagccggctatctccctaccatcagtctgagtgcatctacggggagtatg
acaaacagtgccagtgataatagctggagcaaacaaatgaaatatggctggaataatatg
ataggattgaatataaacattccgatttttgataatcgccagaacaaaagtgctgtgcag
aaggcacgtttgcaatatgatagtagtctactcgatttgataaacaagcaaaaggaactc
tataagaatatagaaagtctgtggttggacgctactaatgctcaagagcaatatgcggcg
gctgagagtaagctgaaaagtagccaggccagttatgagatggtcagcgagcaattcaac
ttgggaatgaagaataccgtagagttgcttaccgagaaaaataacctgctcagtgcacag
cagcaacgtattcaggccaagtatatggctatcttggatcggactctactgaacttctat
gcaggtcaggatataaaattataa

DBGET integrated database retrieval system