KEGG   Bacteroides vulgatus: BVU_2801Help
Entry
BVU_2801          CDS       T00546                                 

Definition
(GenBank) periplasmic component of efflux system
  KO
K02005  HlyD family secretion protein
Organism
bvu  Bacteroides vulgatus
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BVU_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 OEP HlyD Biotin_lipoyl BLOC1S3
Motif
Other DBs
NCBI-ProteinID: ABR40447
UniProt: A6L433
Position
3574416..3575639
Genome map
AA seq 407 aa AA seqDB search
MEKKKMILTTAVAVVVVAGGFWMLGGPEGKSTVDFSTETVTKGNVSNFITATGTIEPVTE
VEVGTQVSGIIDKIYVDYNSVVKKGELIAEMDKVTLQSELQSAKATYDGNEAEYDYQKKL
YDRNRKLHEKQLISDMDYEETVYNFQRAQSALEQSKAALAKAERNLSYATITSPIDGVVT
SRDVEEGQTVASGFETPTLFTIAADLTKMQVVADVDEADIAGVEEGTRVTFTVDAYPDDV
FEGVVRQVRLGSTNSTSSSSSTTTSTTVVTYEVVITADNPYLKLKPRLTANATIYTLTKD
NVLTVPNKALRFTPNKDIVGGRKINDCQSSHKVWTLDNNTFTAHPVKIGITDGSKTEIVS
GITENTPVVTETVVKGAMPGMEEPSAGEGERSPFMPGPPGSNKKKNK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaaaatgatccttactacagcggtagccgtagtggtcgtggcaggcggt
ttctggatgcttggcggaccggagggaaaaagtacggtcgatttctcaacggaaaccgta
acgaaaggtaatgtcagcaatttcattactgctaccggaaccatagagccggtgacagag
gtggaagtgggtacgcaggtatctggtattattgacaagatttatgtggattacaattct
gtggtaaagaaaggagaattgatagccgagatggataaagtgacactgcaaagtgaactt
cagtcggcaaaggccacttatgacggcaatgaggccgagtacgattaccaaaagaaatta
tatgaccgcaaccgtaaactgcacgagaagcaattaatcagcgatatggactatgaagaa
acggtttataatttccaacgtgcccaaagtgcattggagcaaagcaaggcggctctggca
aaggctgagcgtaacctgtcatacgcaaccatcacctcgcctatcgatggagtggtgacc
agccgtgatgtggaagaaggacagaccgtagcatccggtttcgaaactccgacactgttc
accatcgctgccgacttgaccaagatgcaggtggtggccgatgtggatgaagccgatatt
gccggggtggaggaaggaacccgtgtaacctttaccgtggatgcttatcccgacgatgtg
ttcgaaggagtagtcagacaggttcgtttgggaagtacgaacagcacgagcagcagctct
tcaacaaccaccagtaccactgtagttacttatgaggtagtgataacagctgataatccc
tatttgaaactgaaaccgcgtcttaccgccaacgctaccatttatacattgaccaaggat
aatgtgttgaccgttcccaacaaggctttgcgctttactcccaacaaagacatagtggga
ggtcgtaagataaacgattgccagagcagtcataaagtgtggacactggataacaatacc
tttaccgcccatcctgtgaaaataggtattactgatggcagcaagacagagattgtgagt
ggcatcactgaaaatacgccggtagtgacagaaacggtagtgaaaggtgctatgcctgga
atggaagagccgtctgccggagaaggtgagagaagtccgttcatgccaggccctccggga
agcaataagaaaaagaacaagtaa

DBGET integrated database retrieval system