KEGG   Bacteroides vulgatus: BVU_2802Help
Entry
BVU_2802          CDS       T00546                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bvu  Bacteroides vulgatus
Module
bvu_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bvu02000]
    BVU_2802
Transporters [BR:bvu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    BVU_2802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_21 AAA_29 RsgA_GTPase SMC_N FtsK_SpoIIIE IstB_IS21 AAA_28 MMR_HSR1 AAA_18 AAA_16 APS_kinase AAA_25 G-alpha
Motif
Other DBs
NCBI-ProteinID: ABR40448
UniProt: A6L434
Position
3575681..3576424
Genome map
AA seq 247 aa AA seqDB search
MKKIIELQNIKRNFQVGDETVHALRGISFTIYEGEFVTIMGTSGSGKSTLLNTLGCLDTP
TSGEYLLDGVSVRTMSKPQRAVLRNRKIGFVFQNYNLLPKTTAVENVELPLMYNSSISAS
ERRKRAIESLIAVGLGDRLEHKSNQMSGGQMQRVAIARALVNNPAVILADEATGNLDTRT
SFEILVLFQKLHAEGRTLIFVTHNPEIAQYSSRNIRLRDGHVVEDTINPQILSAAAALAA
LPKNDED
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagataatcgaattacaaaatataaaacggaacttccaggtaggcgatgaaacc
gtccacgctctgcgtggcatctcttttaccatttatgaaggagagtttgtcactatcatg
ggtacttctggttccggcaagtccactctgctgaatactttgggatgtcttgatacccct
accagtggtgaatacctgttggatggtgtgtccgtgcgtaccatgagcaaacctcagcgg
gctgtgttgcgcaaccgtaaaataggttttgtatttcagaactataatctgttgcctaag
acgactgccgtagagaatgtggagttgcccttgatgtataactcgtccatatcggcttcc
gaaagacggaaacgtgccattgaatcactgatagccgtggggctaggtgaccgtttggaa
cataaatccaaccaaatgtccggcggacagatgcagcgtgtggccattgcccgtgctctg
gtgaataatcctgccgttattttggctgatgaagcgaccggtaatctggatacccgtacc
tctttcgaaattctggtacttttccaaaagttacacgccgaaggccgtacacttattttt
gtcactcacaatcccgaaatagcccagtatagcagccgtaatatccgcttgcgtgacggg
catgtagtggaagataccatcaatcctcagatcctttcggccgctgccgcgctggctgcc
ttgcccaagaatgatgaggactaa

DBGET integrated database retrieval system