KEGG   Bacteroides vulgatus: BVU_2809Help
Entry
BVU_2809          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABR40455
UniProt: A6L441
Position
complement(3585382..3585627)
Genome map
AA seq 81 aa AA seqDB search
MAEKKESYSEEELNEMIVWFNNHADELPKEMQINKAAFTPDLKLTVESCIMQAKQCLGNY
KMAEAFRMLQQIRENLENAVE
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaaaaagaatcttattccgaagaggaattgaatgaaatgatcgtatggttc
aataaccatgctgatgaacttccaaaagaaatgcagattaacaaagcggcttttaccccg
gatttgaaacttactgttgaaagttgtatcatgcaggctaagcaatgtctgggcaactat
aagatggccgaggctttccggatgctccaacaaatcagagagaaccttgaaaatgcagtc
gaataa

DBGET integrated database retrieval system