KEGG   Bacteroides vulgatus: BVU_2824Help
Entry
BVU_2824          CDS       T00546                                 

Definition
(GenBank) putative RNA polymerase ECF-type sigma factor
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 HTH_23 CENP-B_N HTH_30 HTH_AsnC-type HTH_24 Ribosomal_L7Ae HTH_28 Sigma70_ECF HTH_38
Motif
Other DBs
NCBI-ProteinID: ABR40470
UniProt: A6L456
Position
complement(3599578..3600063)
Genome map
AA seq 161 aa AA seqDB search
MTDFNREIADLYPWLFKIARRYCSSVCDIEDLVGDTIYKVLSNKEKFKEGRALKPWCEVI
MLNTYITAYNRRSLIRFVGCDNIKEIFSHNQASDDLMVHDIQAAIRRCHNRTCCMDCVVY
YAHGYSYKEIGKMVGIPVNTVRSRISYGRELLRNELDLTVK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttcaatcgtgagatagcagatttgtatccatggcttttcaaaatagcaaga
agatactgttcatccgtatgcgatatcgaggatcttgtcggtgacaccatctataaggtt
ttaagcaataaagaaaaattcaaggagggcagggctctgaaaccctggtgtgaggttatc
atgctgaacacctatatcactgcctataatcgaagatcactaatccgatttgtggggtgt
gacaacattaaagagatattctcccataatcaagcctctgatgacttgatggtacatgac
attcaggctgcaataaggagatgccataacagaacctgctgtatggactgtgtggtttac
tacgcacacggatattcatacaaagaaataggcaaaatggtcggaataccagtaaatacc
gtaagaagccgtatctcttacggtcgggaactgctgaggaacgaactggatttaaccgtt
aaatag

DBGET integrated database retrieval system