KEGG   Bacteroides vulgatus: BVU_2825Help
Entry
BVU_2825          CDS       T00546                                 

Definition
(GenBank) hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TelA Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: ABR40471
UniProt: A6L457
Position
complement(3600060..3600329)
Genome map
AA seq 89 aa AA seqDB search
MNNKRIVNALAALILPGLDRLDQKCNRIISELSELKSTLRHSERNIDTLIDKLENSASEL
LKQAQMYHLELEKNLSEELSLFTLKIVKK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaagaatagttaatgccctggctgctctcatattgccgggtctggatcgt
ttggatcagaaatgcaacaggattatttccgagttatcagaattgaaaagcaccctccgc
cactctgaaaggaatattgacacgcttatcgacaaactggaaaattccgcaagtgaatta
ttaaaacaggcgcagatgtatcatcttgagcttgaaaagaatctgagtgaggaattatca
ttattcacccttaaaattgtgaaaaaatga

DBGET integrated database retrieval system