KEGG   Bacteroides vulgatus: BVU_2877Help
Entry
BVU_2877          CDS       T00546                                 

Definition
(GenBank) putative electron transport protein
  KO
K18929  L-lactate dehydrogenase complex protein LldF
Organism
bvu  Bacteroides vulgatus
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BVU_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LUD_dom Fer4_8 Fer4_10 Fer4_17 Fer4_2 Fer4_7 DUF3390 Fer4 Fer4_6 Fer4_18 Fer4_9 Fer4_21 Fer4_4 Fer4_16 Fer4_13 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABR40519
UniProt: A6L4A5
Position
3641759..3643126
Genome map
AA seq 455 aa AA seqDB search
MSTKHSKAAAEFLKNKKQAAWHDETLWLVRAKRDRLSKEVPEWEELRNMACATKLYSNSH
LDELLVEFENNARANGAHVYWAKDADEYCNIVYNILNQHGVKHFIKSKSMLAEECELNPF
LESKGIEVVESDLGERILQLMHLKPSHIVLPAIHIKREQVGELFEREMGTEKGNFDPTYL
THAARKNLRQKFIHAEAAMTGANFAVASTGEIVVCTNEGNADMGTSQPKLQIAAFGMEKI
VPDRESLGVFTRLLARSATGQPITTYTSHYRKPREGGELHIIIVDNGRSKILADPKHIKT
LNCIRCGACMNTCPVYRRSGGYSYTYFIPGPIGINLGMLKAPLHYYDNVSACSLCYSCSF
VCPAKVDLAEQIYLWRQDLDKLGKADRMKKVMSGGMEFMMKRPSIFNMALKWAPLVNGVP
RFLIYNGLNDWGKGREMPKFAKESFNEMWKKGKVK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgaaacattcaaaagcagctgcggagtttctgaaaaacaagaaacaggccgca
tggcatgacgaaacactttggctggttagggcaaagcgtgacagactgagtaaagaagtt
cccgaatgggaggaattgcgtaatatggcatgtgctactaaactatatagtaacagccat
ttggacgaattattggtggagtttgaaaacaatgcgcgtgctaacggagctcatgtctat
tgggcaaaggatgcggatgagtattgtaacattgtctacaatattctgaaccagcacgga
gtgaagcattttataaaaagcaaatccatgttggccgaggagtgtgaacttaatcctttt
ttggaaagcaaagggattgaagtggtagaaagcgacttgggagagcgtatcttgcaattg
atgcatctgaagccgagccatattgtattgcctgctattcatatcaaacgtgaacaggta
ggtgagcttttcgagcgagagatgggtacggagaaaggaaattttgaccctacttacctt
acacatgcagcccggaaaaatctccgtcagaaatttattcatgctgaggcggctatgaca
ggtgctaactttgctgtagcttctactggtgagattgtggtatgtaccaatgaaggaaat
gcggatatgggtacttcccagcctaaattacagattgcggcttttggtatggaaaaaatt
gtgccggatcgtgaatcattgggagtgttcacccgtttgttggcccgttcggctacagga
caacccattactacatatacttctcattatcgaaagcctagagagggtggggaacttcat
attattattgtagataacggacgtagtaagatattagccgacccaaagcatatcaagact
ttgaattgtattcgttgtggagcctgtatgaatacatgtcctgtatatagacgtagtggg
gggtactcttatacttattttattcccggccctatcgggattaacctggggatgttgaag
gcgccgttacattattatgacaatgtgtcggcttgttctttgtgttattcctgttcgttt
gtatgtccggctaaagtggatttggcggagcagatctatttgtggcgccaggatttggat
aaattgggtaaggcagaccggatgaaaaaggtaatgtccggtggcatggaattcatgatg
aagcgcccttcgatattcaatatggcattaaaatgggcgccattggtaaacggagtgccg
cgttttcttatctataacggattgaatgactgggggaaaggacgtgaaatgccgaaattt
gctaaggagagtttcaatgaaatgtggaagaaaggtaaagtgaagtaa

DBGET integrated database retrieval system