KEGG   Bacteroides vulgatus: BVU_2894Help
Entry
BVU_2894          CDS       T00546                                 

Definition
(GenBank) DNA polymerase III, beta chain
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
bvu  Bacteroides vulgatus
Pathway
bvu00230  Purine metabolism
bvu00240  Pyrimidine metabolism
bvu01100  Metabolic pathways
bvu03030  DNA replication
bvu03430  Mismatch repair
bvu03440  Homologous recombination
Module
bvu_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bvu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BVU_2894
   00240 Pyrimidine metabolism
    BVU_2894
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BVU_2894
   03430 Mismatch repair
    BVU_2894
   03440 Homologous recombination
    BVU_2894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bvu03032]
    BVU_2894
   03400 DNA repair and recombination proteins [BR:bvu03400]
    BVU_2894
Enzymes [BR:bvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BVU_2894
DNA replication proteins [BR:bvu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BVU_2894
DNA repair and recombination proteins [BR:bvu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BVU_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Motif
Other DBs
NCBI-ProteinID: ABR40533
UniProt: A6L4B9
Position
complement(3660459..3661583)
Genome map
AA seq 374 aa AA seqDB search
MKFIVSSTGLFSHLQAISRVINSKNSLPILDCFLMELTDGTLSLTASDSETTLSTSLEVN
ESDGDGRFAVSSKTILEALKEIPEQPLTFLVNTENLEITVQYQNGKYSLMGQNADEYPQA
PALGANAVHVTMGAPVMLAGINRSLFATADDELRPVMNGIYFDITTEDITFVASDGHKLV
RNKTFVAHGDEKAAFILPKKPATLLKNLLPKEQGDVQIDFDDRNATFTLENYSMICRLIE
GRYPNYNSVIPQDNPHKATIDRMMLISALRRVSVFSSQASSLIKLRLSENQIQISAQDID
FSTSAEETLTCQYTGSPMSIGFKSTFLIDILNNISAQEILFELADPSRAGVIVPVEQEEK
EDLLMLLMPMMLND
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatcgtttcaagtactggattattcagtcatttacaagctattagccgagta
atcaactctaaaaattcgttacctattcttgattgtttcttaatggaactgactgacgga
acgttgtcgctcactgcctctgacagcgaaacgaccctctccacttctttggaagtaaat
gaaagtgacggtgacggacgctttgccgtttcttcaaaaaccatactcgaagccctgaaa
gaaatacccgaacaaccactgactttcctggtaaatacagagaatctggaaatcaccgta
caatatcagaatggtaaatacagcctgatgggacaaaatgccgacgaatatccgcaggct
cccgcattaggcgcaaatgcggtacacgtaacaatgggcgctccggtgatgctggcgggt
atcaaccgttccttgttcgctactgccgatgacgagttacgtccggtaatgaatggtatt
tattttgatatcactaccgaagacatcactttcgtagcctcagacgggcacaaattagta
cgcaataaaacatttgtggcacacggcgatgaaaaagccgctttcattctgcccaagaaa
ccggcaaccctgctgaagaacctgttgccgaaagaacaaggagatgtgcaaattgatttt
gacgaccgtaacgctacgtttacattagaaaactacagcatgatatgccgtcttatcgaa
ggacgctatcccaattataattcagtaattccgcaggataatccgcacaaggccaccatt
gaccgcatgatgctgatcagtgcgctccgccgtgtatctgtattctcatcacaagcaagc
agtttgataaaactccgcctcagtgaaaatcagatccagatctccgcacaagacatagac
ttctccacctcagcagaagaaacactgacttgccaatatacaggaagccccatgagcatc
ggctttaaatcaacattcctgatcgatattttaaacaatatctcggcacaggaaatactt
ttcgaactggctgatccttcacgtgcgggtgttattgttcctgtagaacaggaagaaaaa
gaagacctgctgatgctgctgatgcctatgatgctgaacgactaa

DBGET integrated database retrieval system