KEGG   Bacteroides vulgatus: BVU_2895Help
Entry
BVU_2895          CDS       T00546                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3127
Motif
Other DBs
NCBI-ProteinID: ABR40534
UniProt: A6L4C0
Position
3661737..3662114
Genome map
AA seq 125 aa AA seqDB search
MELAGKVIAVLEPRGGVSKTGNEWKVQEYVIETHDQYPKKMCFDVFGADKIAQFNIQAGE
ELNVFFDVDAREWNGRWFNSIRAWKVERVGAQGPVAPDAPFPPMNAAPAAPVDFAATDEK
DDLPF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaattagcaggaaaagtaatagcagtcctcgaaccgagaggaggagtttcaaagaca
ggaaatgaatggaaagtacaagaatacgtaattgaaacgcatgatcaatatcctaaaaaa
atgtgttttgacgtatttggagcagataagatagcgcaatttaatattcaggcaggtgaa
gagttgaatgtgttttttgatgtggatgcccgcgagtggaatggtcgttggttcaacagt
atccgtgcgtggaaagtagagcgtgtgggtgcccagggacctgttgcaccggatgctccg
tttcctcccatgaatgctgctcccgctgcaccggtagattttgccgcgacagacgagaag
gatgatttgcctttctag

DBGET integrated database retrieval system