KEGG   Bacteroides vulgatus: BVU_2911Help
Entry
BVU_2911          CDS       T00546                                 

Definition
(GenBank) two-component system sensor histidine kinase/response regulator, hybrid
Organism
bvu  Bacteroides vulgatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reg_prop Response_reg HATPase_c HTH_18 HisKA Y_Y_Y HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ABR40550
UniProt: A6L4D6
Position
3682397..3686800
Genome map
AA seq 1467 aa AA seqDB search
MKKYILIILCCLTSFPLWSYNVNMIVEHYSVDQGLPNNTVNCTLKDRDGFIWFGTWYGLC
CFDGVKFKTFNKQEHDSDVPPRKIQRIVEDKNGYIWVKTIDRKLYVFNKVTECFHAVYDD
MKNYSENIQVIKLQNTAEGDVLLLTKDKNLLLAGVDEKGQVTIKILFDSRDEINKHDYTL
KHHVLCETEEYISWIGTDYKVSAVHKGAELASRPADFITSKINSGDKDSFTSFFEDGRKV
WVGDRAGIFYSIDVRTGLVNRYVLSEIKGAISNLLVTPAGYVYLSVAGQGTYEYDLAERR
LQKINTEMNDAMVTHAFIDQYDKIWFHENEKALIYYDPLNHTAKRFPFTMFGKITTLYSE
DAGERGLFFLSPAGEAWLFDREHVEMVYINKLKQLSNDRANQQFYHLMLDNDGVLWLSSA
DEGVYCMNFPKKQFNLLSLSPQSAGRENYATGVRALFQSKSGDIWVGTRWQSVYRMDRNG
VTKHVFSTGDEHIGNVYHIMEDDKGNLWFSTKGDGLVKAVPDEKAAGGFRFKRYLHNLSD
LSSISGNDVYFTYQDEKKGIWVGTLDGGLNLLCEENGEVTFKNKYNGFKNYPTYGLYMEV
RNMIEDNDGRMWVGTMDGLMSFKNNFASVEQIDFETYRGSNRVNYADSDVYALYKDEFSQ
IWVCVFGGGLSKLSGYDEETHKLSFKSYGWEDGLNNDVVMSIIEDDNGFLWLATEKGLSC
FDRATSQVRNYDKYDGFPPVVMEENTALKTLDGELWLGCKEGILTFSPDKLETQRFDYNT
FIVGCQISNRDIRSYTDHPIIDRSITYTDRITLNHNQSMFTLEFAALNYNNQNRVSYKYI
LEGYEKEWHYNGKNRIASYTNVPPGKYLFRVQTLDEANPGLESFRELTVVILPPWWASWW
AYVIYMIIAVALLLVAIKLSLFMIKVKNDVYIEQKLSELKIKFFTNISHELRTPLTLIQG
PIQELREKEKLSQKGMQYVDLMEKNTKQMLQLVNQILDFRKIQNGKMRLHVSLFNLNEMV
DSFEKEFRVMAEENEVSFTFQLAGEDIMVWADKEKVAIVIRNIISNAFKFTPAGGNIYVT
MGVSDDDRHCYVRVEDSGVGIPQSKLSEIFERFSQADNARGAYYQGTGIGLALSKEIISL
HHGEIYAESPEGKGAVFTIELQLGKEHYKPSEVDFYMGGETVSVPEAESVSASAGKESEE
EKEQPVDSSLPTVLIVEDNKDLCNMLKLQLEDKFNIYMANDGVEGLKKVHLYHPDMVVTD
QMMPNMDGIEMLQRIRKDFQISHIPVIILTAKGNDEAKTKAISMGANAYIIKPFSKDYLV
ARIEQLLNERKLFRERVWQQPEEHKEEQDTYEQFLVKKDVQFIEKIHQVIEENLDNSDFN
IDTIASTIGLSRSAFFKKLKSLTGFAPVDLVKEIRLNKSIELIKNSDMSISEIAFAVGFK
DSGYFSKCFRKKYDQTPREYMNEWRKG
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatatacttattatactttgttgcctgacaagctttcctctgtggtcatat
aatgtgaatatgattgtggaacattattctgtagatcaagggcttcctaataatacggta
aactgtaccttgaaagacagagatggctttatctggttcggaacctggtatggcttatgt
tgtttcgatggagtgaagtttaaaacattcaataaacaggagcacgattcggatgtgccg
ccacgtaagatccagcgcatagtcgaggataaaaacgggtatatatgggtaaagaccatt
gaccgtaagttgtatgtcttcaataaagtgaccgaatgttttcatgctgtttatgatgac
atgaagaactattcggagaatattcaggtgataaaattacaaaatacggccgagggggat
gtgttgttgctgaccaaagataaaaatctgttgttggccggggtagatgaaaaggggcag
gtaactatcaagattctgttcgactctcgggacgagataaacaagcatgattatacactg
aaacaccatgtcctgtgcgaaacggaggaatatatcagttggataggaactgattataag
gtgtctgccgtgcataaaggagcggaattggcatcccggcctgccgatttcataaccagt
aagattaattccggtgacaaggatagttttaccagtttctttgaggatggcaggaaggta
tgggtcggagatcgtgcgggtattttttacagtatcgatgtaaggaccggtttggtaaac
cggtatgtactttccgaaataaaaggtgcgatcagcaatttgctggttactccggcaggt
tatgtctatctcagtgtggccggacaaggtacatacgaatatgatttggccgagcgcagg
ttgcaaaagataaatactgaaatgaatgacgctatggttactcatgcattcatagaccag
tatgataaaatatggtttcacgaaaatgagaaggcgctgatttattatgatccgttgaac
cataccgcaaaacggtttccgtttaccatgttcggcaagataaccaccctgtattcggaa
gatgccggcgaaagagggctttttttcctgtctccggcaggagaggcctggttgttcgac
agggaacatgtggagatggtttatattaataaattgaaacaactttctaatgatagggca
aatcagcagttttatcatctgatgttggataatgacggggtattgtggctttcctctgcc
gatgaaggggtgtattgcatgaatttccccaagaagcaattcaatctgctttcgttgtct
ccgcaatcagccggtcgggaaaattatgcgacaggggtaagagcccttttccaatcaaaa
agtggcgatatctgggtgggcacccgttggcagagtgtttatcggatggaccggaacggt
gtaaccaaacatgttttttcgacaggtgacgagcatataggtaatgtatatcacatcatg
gaagacgacaagggaaacctttggttctctaccaaaggcgacggattggtgaaagctgtt
cctgatgagaaagctgcaggtggtttccgttttaaacgctatctgcataatttgtctgat
ttgtcgtcgatcagcgggaatgatgtgtatttcacttatcaggatgaaaagaaaggtatc
tgggtgggtactttggacggaggattgaatctgctttgtgaggaaaatggggaagtcact
tttaagaataaatataacggattcaagaactatcctacgtatggcctttatatggaagtg
agaaatatgatagaggataatgacgggcgtatgtgggtaggtacgatggacgggctgatg
tcttttaaaaacaactttgcctcagtggagcagattgattttgaaacctatcgtggttcc
aaccgggtaaattatgccgatagcgatgtgtacgcgctttataaagacgagttctctcag
atatgggtatgtgtgtttggtggaggattgagcaaattgtcgggatacgatgaggaaacg
cataagctttcatttaaatcgtatggctgggaagacggattgaataatgatgtggtgatg
tctattatagaagatgataacggttttctttggcttgctacagaaaaaggactctcttgt
tttgacagagcgacaagccaggtgcgtaactatgacaaatatgatggctttcctccggtt
gtgatggaagaaaacaccgcactgaaaacgctggacggagaactttggctggggtgtaaa
gagggtatcttgaccttttctcccgataagctggaaacgcaaagatttgattataataca
tttattgtaggatgtcagatatcaaaccgggatatacgcagctatacggaccatcccatt
attgaccggtccattacctatacagacaggattacattgaatcataaccagtccatgttt
actttagagtttgcggcgttgaactataataatcagaaccgtgtgtcttacaaatatatt
ttggaaggatatgaaaaagaatggcactataacgggaagaaccgtatagcatcctatacc
aatgttcctcccggcaagtatcttttcagagtacagacactggatgaggcaaatcccggt
ttggagtctttccgtgagttgaccgttgtcattctgccgccttggtgggccagttggtgg
gcgtatgttatctatatgattatagccgtagccttattgctggtggctataaaattatct
cttttcatgattaaggtgaagaatgatgtgtatatcgaacaaaaattgtccgaattgaaa
atcaagttctttaccaatatctcgcatgagttgcgtactccgctgactctgatccaaggg
cctattcaggaactgagagaaaaggagaaactatctcagaaaggaatgcaatatgtggat
ctgatggaaaagaataccaaacagatgctgcaactggtcaatcagatattggatttccgt
aaaatacagaacggcaagatgcgtctgcatgtgtcgttgttcaacctgaatgagatggta
gactcttttgagaaagaattcagggtgatggccgaagaaaatgaagtcagcttcacgttc
cagctggccggtgaggatatcatggtatgggcggataaggagaaagtggctatcgtgatc
cgcaacatcatctccaatgcgttcaagttcactcctgccgggggaaatatttatgtcacg
atgggagtgtcggatgatgacaggcattgttatgtacgggtggaagatagcggtgtgggg
attccccaaagcaagctttccgaaatcttcgagcgtttctcgcaggctgacaatgcacgt
ggcgcttattatcagggaacgggcatcggattggctttgtctaaggaaattatcagtctg
catcatggggaaatctatgcagagagtcctgaagggaagggagcggtctttaccattgaa
ttgcaactgggtaaggagcattacaaaccgtcggaagtcgatttctatatgggcggggaa
acggtgagtgttcctgaggctgaatctgtttctgcctctgccggcaaggaaagcgaggag
gagaaagaacagcctgtcgattcgtctttgcctaccgtgctgattgtagaagataataag
gatttatgcaatatgttgaagctgcaattggaagataaattcaatatttatatggccaat
gatggtgtggaggggctgaagaaagtacatctttatcatcccgacatggtagtcaccgac
cagatgatgccgaatatggatggaatagagatgttgcaacgcatccgtaaagatttccag
atcagtcatattccggtgattatcctgacggcgaaaggtaatgatgaagcgaagaccaaa
gcgataagcatgggagcgaatgcctatatcatcaaacctttcagcaaagactatctggta
gcacgtatcgaacagttgctgaatgaacgtaaattgttccgtgaacgtgtatggcagcag
cccgaagaacataaggaggaacaggatacatacgaacagttcctggtgaagaaagatgtg
cagttcattgaaaagattcatcaggttatagaagagaatctggataatagtgattttaat
atagatactatagcatcgactatcgggctgagccgctcggctttctttaagaagttaaag
agcctgaccgggtttgctccggtggatttagtgaaagagattcgtctgaataaatcaata
gagttgattaaaaactcggatatgagtatttcagaaatagcttttgccgtgggcttcaag
gattccggttatttcagtaaatgttttcgtaagaaatatgatcagactccgagggaatat
atgaatgaatggcgtaaaggttga

DBGET integrated database retrieval system