KEGG   Bosea vaviloviae: BHK69_00800Help
Entry
BHK69_00800       CDS       T04483                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00071  Fatty acid degradation
bvv00072  Synthesis and degradation of ketone bodies
bvv00280  Valine, leucine and isoleucine degradation
bvv00310  Lysine degradation
bvv00362  Benzoate degradation
bvv00380  Tryptophan metabolism
bvv00620  Pyruvate metabolism
bvv00630  Glyoxylate and dicarboxylate metabolism
bvv00640  Propanoate metabolism
bvv00650  Butanoate metabolism
bvv00900  Terpenoid backbone biosynthesis
bvv01100  Metabolic pathways
bvv01110  Biosynthesis of secondary metabolites
bvv01120  Microbial metabolism in diverse environments
bvv01130  Biosynthesis of antibiotics
bvv01200  Carbon metabolism
bvv01212  Fatty acid metabolism
bvv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BHK69_00800
   00630 Glyoxylate and dicarboxylate metabolism
    BHK69_00800
   00640 Propanoate metabolism
    BHK69_00800
   00650 Butanoate metabolism
    BHK69_00800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BHK69_00800
   00072 Synthesis and degradation of ketone bodies
    BHK69_00800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BHK69_00800
   00310 Lysine degradation
    BHK69_00800
   00380 Tryptophan metabolism
    BHK69_00800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BHK69_00800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BHK69_00800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BHK69_00800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvv04147]
    BHK69_00800
Enzymes [BR:bvv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BHK69_00800
Exosome [BR:bvv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BHK69_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOO79227
UniProt: A0A1D7TVT7
Position
172941..174119
Genome map
AA seq 392 aa AA seqDB search
MADTDIVIVGAARTAVGAFNGAFANTPAHELGAAAIKEALARAKVEGAEVDEVIMGQILT
AGQGQNPARQAAMAAGIPQEATAWGLNQLCGSGLRAVAIGLQQIVNGDADIIVAGGQESM
SMSQHGAHLRNGTKMGDMKFVDTMIKDGLWDAFHGYHMGTTAENVATKWQISREEQDKFA
VGSQNKAEAAQKAGRFKDEIVPFTIAGRKGDIIVSDDEYPRHGATIEAMAKLRPAFSKEG
TVTAGNASGLNDGAAALVLMSAKEAARRGLTPLARIASWATAGVDPAIMGSGPIPATRKA
LERAGWSISDLDLVEANEAFAAQALAVNKDLGWNTDIVNVNGGAIAIGHPIGASGARVLV
TLLHEMAKRDAKKGLATLCIGGGMGVALTVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacggacatcgtcatcgtcggcgcagcacgcaccgccgtcggcgccttcaac
ggcgccttcgccaacactccggcccatgagctcggcgccgccgcaatcaaggaagcgctc
gcccgcgccaaggtcgaaggggccgaggtcgacgaggtcatcatgggccagatcctgacc
gccggtcagggccagaacccggcgcgccaggccgcgatggcggcgggcatcccgcaggag
gccaccgcctggggcctcaaccagctttgcggctccggcctgcgcgcggtggcgatcggc
ctgcagcagatcgtcaatggcgatgccgacatcatcgtcgccggcggccaggaatcgatg
tcgatgtcgcagcatggcgcgcatctgcgcaacggcaccaagatgggcgacatgaagttc
gtcgacaccatgatcaaggacgggctctgggacgccttccacggttaccatatgggcacc
accgccgagaacgttgcgaccaaatggcagatcagccgcgaggaacaagacaaattcgcc
gtcggctcgcagaacaaggccgaggccgcccagaaggccggccgcttcaaggatgagatc
gtccccttcaccattgccggccgcaagggcgacatcatcgtctccgacgacgaatatccc
cgccatggcgcgacgatcgaggccatggccaagctccgccccgccttctcgaaggagggc
accgtcaccgccggcaacgcctcgggcctcaatgacggcgccgccgcgctcgtgctgatg
agcgccaaggaagccgccaggcgcggcctgaccccgctcgcccgcatcgcctcctgggcg
accgcaggcgtcgacccggcgatcatgggctcgggtccgatcccggcgacgcgcaaggcg
ctggagcgggccggctggagcatcagtgatctcgatctcgtcgaggccaacgaggctttc
gcagcgcaggcgctggcggtcaacaaggaccttggctggaacaccgacatcgtcaacgtc
aatggcggcgcgatcgcgatcggccatccgatcggcgcatccggcgcgcgcgtgctggtg
acgctgctgcacgaaatggccaagcgcgacgccaagaagggcttggctacgctctgcatc
ggcggcggcatgggcgtggcgctcacggtcgagcgctga

DBGET integrated database retrieval system