KEGG   Bosea vaviloviae: BHK69_05440Help
Entry
BHK69_05440       CDS       T04483                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bvv  Bosea vaviloviae
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BHK69_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AOO79996
UniProt: A0A1D7TY03
Position
complement(1153262..1153654)
Genome map
AA seq 130 aa AA seqDB search
MYQAETHGVRVTAAPKFMEGESSHEQRRYFWAYSIEIVNLSLQTVQLMTRHWFITDGRGE
VHEVRGDGVIGQQPVLRPGESFSYTSGCPLMTPDGSMSGFYAMLGEDGAIFNVVVPLFPL
DSPYVKKVLH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagcggagacgcatggcgtgcgcgtgaccgccgcgccgaaattcatggagggg
gaatcctcgcatgagcagcgccgctatttctgggcctattccatcgagatcgtgaatttg
tcgcttcagaccgtgcaattgatgacccggcactggttcatcaccgatggccgcggcgag
gttcatgaagtgcgcggcgacggcgtcatcggccagcagccggtgctgcgcccgggcgag
agcttcagctatacctccggttgcccgttgatgacgccggacggctcgatgagcggcttt
tacgccatgctcggcgaggacggcgcgatcttcaatgtcgtcgtgccgctctttccgctc
gattcgccctatgtgaagaaggttctgcattga

DBGET integrated database retrieval system