KEGG   Bosea vaviloviae: BHK69_08660Help
Entry
BHK69_08660       CDS       T04483                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00361  Chlorocyclohexane and chlorobenzene degradation
bvv00625  Chloroalkane and chloroalkene degradation
bvv01100  Metabolic pathways
bvv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BHK69_08660
   00361 Chlorocyclohexane and chlorobenzene degradation
    BHK69_08660
Enzymes [BR:bvv01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BHK69_08660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like RNR_Alpha
Motif
Other DBs
NCBI-ProteinID: AOO80524
UniProt: A0A1D7TZH5
Position
complement(1852286..1852999)
Genome map
AA seq 237 aa AA seqDB search
MMPTQTSPTVVFDVGNVLLRWDPRLLYRELIPDPAKLDWFMQNVCTAAWNIEQDRGRSWE
EAVALLVASHPEWTREIKAFDERWHETVPGVIEDNVALLAELKAKGEKVYAITNFSREKW
AECLIRFPFLQSFDGAIVSAHEGLIKPDVAIYHTLLERYALSAPDCIFIDDSHKNVEAAR
AVGMKAVHFVEPLDLRAELRGLGVAAYASWPASSRPSRDGDAAPAGDALLQAFLSPR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgacccaaacctcgcccactgtcgtcttcgatgtcggcaacgtcctgctccgc
tgggatccgcgcctgctctatcgcgagttgattcccgatcccgcgaagctcgactggttc
atgcagaatgtctgcaccgccgcctggaacatcgagcaggatcgcggccgctcctgggag
gaggccgtggcgctgctggtcgcgtcccatccggaatggacgcgcgagatcaaggccttc
gacgagcgctggcacgagaccgtgcccggcgtgatcgaggacaatgtcgcgctactcgcc
gaactcaaggcaaagggcgaaaaggtctacgccatcaccaatttctcgcgcgagaaatgg
gcggaatgcctgatccgcttccccttcctgcaaagcttcgacggcgccatcgtctcggcg
catgaaggcctgatcaagccggatgtcgcgatctaccacacgctgctggagcgctatgcc
ctgagcgcgcccgactgcatcttcatcgacgacagccacaagaatgtcgaagcggcgcgc
gccgtcggcatgaaggccgtgcacttcgtcgagccgctcgatctgcgcgccgagctgcgg
gggttgggcgtcgcggcgtatgcgtcatggccggcatcgagccgaccctctcgtgacggt
gacgctgctcctgcaggagatgctcttctgcaggcgtttctcagcccgcgctag

DBGET integrated database retrieval system