KEGG   Bosea vaviloviae: BHK69_24535Help
Entry
BHK69_24535       CDS       T04483                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00020  Citrate cycle (TCA cycle)
bvv00620  Pyruvate metabolism
bvv01100  Metabolic pathways
bvv01110  Biosynthesis of secondary metabolites
bvv01120  Microbial metabolism in diverse environments
bvv01130  Biosynthesis of antibiotics
bvv01200  Carbon metabolism
Module
bvv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BHK69_24535
   00620 Pyruvate metabolism
    BHK69_24535
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BHK69_24535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AOO84748
UniProt: A0A1D7UBJ9
Position
complement(5321612..5323231)
Genome map
AA seq 539 aa AA seqDB search
MTRRRLVGSAVAVGAVAAAGISLTGGQYRAATADRKVDVLLIGGGIMSATLAVLLHELEP
RWTMELMERLDSVAEESSNGWNNAGTGHSALCELNYTPEDAKGNVQIATAVAVNEQFQIS
RQFWAHQLKQGVLKEPRSFINSTPHMNLVWGDDNVTFLQKRFEALKASPLFSGMEFTKDP
AKIAEWVPIMMEGRKASMPLAATKSPLGTDVNFGEITRQFTAFLKSQPEFRLLTGHEVRS
ITRNGDGTWRVSAFDLKTGKAVQTVDARFVFIGAGGTALPLLQLAGIPEAHGYGGFPVGG
SFLVTEKPEIVNRHLAKVYGKASVGSPPMSVPHLDTRMLDGKQVLLFGPFATFSTKFLKN
GSYFDLPSSVSLENIRPMVSVGWNEFDLVEYLAGQLLMSHSGQMDALREYLPQAKDEDWR
LWQAGQRVQIIKKKPEGGGILTFGTEIVAAADGSMAALLGASPGASTSPPIMINLLAKVF
ADKVATPEWQKKLREIIPSYGVKLNDNPGMIADEWAMTEKALELAVASPTVSVKTAAGG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
ctgacccgtcgccggctggttggttcggctgtggcggtcggggctgtcgcggccgcgggg
atttcgctgacgggcggccagtaccgcgccgcgaccgcggatcggaaggtcgatgtcctg
ttgatcggcggcggcatcatgagcgctacgctcgccgtgctgctgcatgagctcgagccg
cgctggaccatggagctgatggagcgcctcgacagcgtcgcggaggaaagctccaacggc
tggaacaatgcgggcacgggccattcggcgctttgcgagctgaactacacgcccgaggat
gcgaaagggaatgtgcagatcgccacggctgttgccgtcaacgagcagtttcagatctcg
cgtcagttctgggcgcatcaattgaagcagggcgtcctgaaggagccacgctccttcatc
aactcgacgccgcatatgaatctcgtctggggtgacgacaacgtcacctttctccagaaa
cgcttcgaggcgctgaaagccagcccgctgttctcagggatggagttcacgaaggacccc
gcgaagatcgccgaatgggtcccgatcatgatggagggccgcaaggcctcgatgccgctc
gcggcgacgaaatcgccattggggaccgacgtcaatttcggcgaaatcacgcgccagttc
accgcattcctgaagagccagccggaatttcgcctgctcaccgggcatgaggtccgctcg
atcacccggaatggggacggcacctggcgtgtctcggccttcgacctgaagaccggcaaa
gcggtgcaaaccgtcgacgcccgcttcgtcttcatcggcgcgggcggcaccgcgctgcct
ctcctgcagctcgcgggcattcccgaagcccatggctatggcgggttcccggtcggcggt
tccttcctggtcacggagaagcccgaaatcgtcaaccgccatctggcgaaggtctatggc
aaggcgtcggtcggttcgccgccgatgtccgttccgcatctcgatacgcggatgctcgac
ggcaagcaggtcctgcttttcgggccgttcgcgaccttctcgaccaagttcctgaagaac
ggctcctatttcgatctgccgtcatcggtctcgctggaaaacatccggccgatggtgtcg
gtggggtggaacgagttcgatctggtcgaatatctcgccggtcagctgctgatgtcccat
agcggccaaatggacgcgcttcgggaatatctgcctcaggcaaaggacgaagactggcgc
ctctggcaggcggggcagcgcgttcagatcatcaagaagaaacccgaaggcggcggtatt
ctgaccttcgggaccgagatcgtggcggccgcggacgggtccatggcggcgctgctcggc
gcatccccgggggcttcgacctcgcctccgatcatgatcaatctcctcgccaaggtgttc
gctgacaaagtcgcgacccctgaatggcagaagaagctccgcgagatcatcccgagctac
ggggtgaagctcaacgacaatcccggcatgatcgccgatgagtgggcgatgacggagaag
gcattggagctggcagtcgcttcgcccaccgtctcggtcaagactgcggcgggaggctga

DBGET integrated database retrieval system