KEGG   Bosea vaviloviae: BHK69_26130Help
Entry
BHK69_26130       CDS       T04483                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00450  Selenocompound metabolism
bvv00970  Aminoacyl-tRNA biosynthesis
bvv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BHK69_26130
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BHK69_26130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bvv01007]
    BHK69_26130
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bvv03016]
    BHK69_26130
Enzymes [BR:bvv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BHK69_26130
Amino acid related enzymes [BR:bvv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BHK69_26130
Transfer RNA biogenesis [BR:bvv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BHK69_26130
 Prokaryotic type
   Other AARSs
    BHK69_26130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AOO83455
UniProt: A0A1D7U7V1
Position
5670798..5672396
Genome map
AA seq 532 aa AA seqDB search
MPIETPDPDASPHRYITTAIPYVNAAPHVGFALEMVQADALARFYRQSGDEVRFQAGTDE
NSIKNVQAANLAGIPVAELVQRNALRFLALKDSLDLSFDDFVRTSADARHKAGTEHLWKA
CCDNGDIYKSAYRGLYCTGCEQFYGVDDLHDGRCPEHGTIPETVEEENWFFRLSRYRDRL
RSLYARGEIEIVPESRRNEVLAWIEQGLTDFSISRSAARAGGWGISVPGDPEQVIYVWFD
ALGSYVTGLGYGSDEALLSRYWTGSASREHVIGKGITRFHAVYWPAMLLSAGLPVPTRIL
VHGYVTLEGRKIGKSAGNAIDPVPLAAELGTDALRYYLLRHIRSTGDGDFSHERFRQAYE
SELAGQLGNLAHRVLSMIERYCGGILPAPPDGFAATDRLLKAGQGLNATVTGHLQAFAFD
HALDALWLFIAEANRYVSEEEPWVLARKATSGQDSGQNSGDATANLAKLHRCLFSLAGAL
QTIAECIVPLLPAASRRLSKKLGKDGGYSAPASPDALIGTRVAAGAPLFPMR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgaaactcctgatccagacgcaagccctcaccgctacatcaccaccgccatc
ccttatgtgaacgccgcgcctcatgtcggtttcgcgctggagatggtgcaggcagatgcc
ttggcccgcttctatcggcaatcgggcgatgaggtgcgcttccaggcggggaccgacgag
aacagcatcaagaacgtccaggccgccaacctcgcgggcatcccggtcgcggaactcgtc
caacgcaacgccctgcgtttcctcgccctgaaggacagcctcgacctttccttcgacgat
ttcgtccgcaccagcgccgacgctcgacacaaggcgggcaccgaacatctatggaaagcc
tgctgcgacaatggcgacatctacaagagcgcctatcgcggcctctattgcacggggtgc
gagcagttctacggggtggacgaccttcacgacggacgctgccccgagcacggcacgatc
cccgaaacggtcgaggaagagaattggttcttccggctgtcgcgctaccgagatcgcctc
cgcagcctctatgcacgcggcgaaatcgagatcgtcccggaaagccgccgcaacgaggtt
ctcgcctggatcgagcaggggctcacggatttcagcatctcacgcagcgcagcgcgagcc
ggtggatggggcatttccgtgcccggcgaccccgaacaggtgatctatgtctggttcgac
gcgctcggcagctatgtcacggggctgggctacggaagcgatgaggctcttctctcccgc
tactggacaggttctgcctcccgcgagcatgtcattggaaagggcatcacccgcttccac
gccgtctattggccggccatgctgctctccgccggcctacccgttccgacgcgcattctc
gtccatggctatgtcacgctcgaaggtcgcaagatcggcaaatccgccggcaacgcgatc
gatccggttccgctcgcggcggagctcggcacggatgcgctgcgctactacctgctgcgc
catatccgctcgaccggcgacggcgacttctcgcacgaacgcttccggcaagcctatgaa
tccgaactcgcgggacagctcggcaacctggcgcatcgcgtcctcagcatgatcgaacgc
tattgcggcgggatcctgccagcgccgccggacgggttcgcggcaaccgacaggctcttg
aaggcaggccagggcctgaacgccacggtcaccgggcatctgcaggccttcgccttcgac
catgcgctcgacgcactctggctcttcatcgccgaggccaatcgctatgtatccgaggaa
gagccctgggtcctggcaaggaaagcgacttcagggcaggattccggccagaattccggc
gatgccactgctaacctcgccaagctccatcgctgcctgttcagccttgccggcgcgctc
cagacgatagcggaatgcatcgtcccgctgctcccggcagccagccgaaggctgagcaag
aaactcggcaaagatgggggctattcagcgccggcctcccccgacgccttgatcggaacc
agggttgcagccggcgcgccgcttttcccgatgcgctga

DBGET integrated database retrieval system