KEGG   Bosea vaviloviae: BHK69_28770Help
Entry
BHK69_28770       CDS       T04483                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bvv  Bosea vaviloviae
Pathway
bvv00250  Alanine, aspartate and glutamate metabolism
bvv00330  Arginine and proline metabolism
bvv01100  Metabolic pathways
bvv01110  Biosynthesis of secondary metabolites
bvv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BHK69_28770
   00330 Arginine and proline metabolism
    BHK69_28770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bvv03000]
    BHK69_28770
Enzymes [BR:bvv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BHK69_28770
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BHK69_28770
Transcription factors [BR:bvv03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BHK69_28770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: AOO84862
UniProt: A0A1D7UBV6
Position
6197484..6200603
Genome map
AA seq 1039 aa AA seqDB search
MATAAPRFVEAPALSAFRVPYAEDDGATAATLLTGARREPAAKARIDARATELIEAIRTR
KVGLGGIEELLREYSLSTKEGLALMVLAEALLRVPDAATADRLIEDKLGQGDFANHESKS
DAFLVSASAWALGITARVIQPGETPTGIIGSLAKRLGVPTVRTATRQAMRVMGNHFVLGQ
TIEEALKRAGSKTGKLYRYSFDMLGEGARTQADADRYLASYSAAIDAIGRSAGNEPLPNR
PGISVKLSALHPRYDATNHERVLAELTPKVIKLAQQAKSYDLNFTIDAEEADRLELSLDV
IDAVVADASLAGWDGFGLAIQAYQKRASAVIDHIAALAEAHGRRMMVRLVKGAYWDTELK
RAQERGLADYPVFTRKAMTDLNYEACAAQLLRLRPRIIPQFATHNALTVASVAEMAGDAE
NFEFQRLHGMGEALYEKLLADKAGYACRTYAPVGGHQDLLAYLVRRLLENGANSSFVSVS
GDPDVPVAQLLVPPADLIGNAGAARHRRIPLPADLYGPSRKNSAGVELGHAESLDALLAE
IAAATAKPFPDASPIIDGKAVGGTPRPVLSPIDGKAIGTVAEADAALAGRAMLAAKAGFD
DWNRTPARTRAAALRKAADLMEAKRGLLLALLQAEAGKTLDDAISEVREAVDFCRYYAAE
AEAKFAMPTALPGPTGEENRLILRGRGPFLCIAPWNFPLAIFAGQVAAALVAGNSVVAKP
APQTPLIATVTVRLLHEAGVPVSALHLTPGDGALGAALVAHPAVAGVAFTGSTATARAIN
RALAAKDGPIVPLIAETGGLNAMIVDATALAEQVADDVVMSAFRSAGQRCSALRLLVVQE
DVADKMVEMITGAGGELKLGDPRRIETHIGPVIDAAAKQRLDSHVEAMRKLGRIVWAGDA
PALGGTFVAPHVVALNSIAELDREHFGPILHVVRWKSGQLDKVIEAIEATGYGLTLGVHS
RIETTVEEVVSRLSTGNIYVNRNIIGAVVGAQPFGGHGLSGTGPKAGGPNYLMRFATEQT
VTVNTAAAGGNASLIAMGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccccgcgtttcgtcgaagcgccagccctgtccgctttccgcgttccc
tatgcggaagacgatggcgcgaccgccgcgacgctgctgactggggcccggcgcgagcct
gccgccaaggcacgcatcgacgctcgcgccaccgaactgatcgaggcgatccgcacccgc
aaggtcggattgggcggcatcgaggagttgctgcgcgaatattcgctttcgaccaaggag
gggctggccctgatggtgctggcagaggcgctgctgcgtgtgcccgacgcggcgaccgcc
gaccggctgatcgaggacaagctcggccagggcgacttcgccaatcacgagtcgaaatcg
gacgccttcctggtctcggcttcggcctgggcgctcggtatcaccgcgcgcgtcatccag
cccggcgaaacgccgacgggtattatcggcagcctcgccaagcgcctcggcgtgccgacg
gtgcgcaccgcgacgcgtcaggccatgcgtgtgatgggcaaccatttcgtgctcggccag
accatcgaggaggcgctgaagcgcgccggttccaagaccggcaagctctatcgctattcc
ttcgacatgctgggcgaaggcgcacgcacgcaagccgacgccgaccgttacctcgcctcc
tacagcgccgcgatcgacgccatcggccgctccgccggcaatgagccgctgccgaaccgg
ccgggcatctcggtcaagctctcggcgctgcatccgcgctatgacgcgaccaatcacgag
cgcgtgctggccgagctgacgcccaaggtgatcaagctcgcgcagcaggccaaatcctac
gatctcaacttcaccatcgatgccgaggaggccgaccggctcgaactctcgctcgacgtc
atcgacgccgtggtggccgatgcctcgctcgccggctgggacggcttcggcctcgccatc
caggcctatcagaagcgtgcctcggccgtgatcgaccatatcgcggcgctggccgaggcc
catggccgtcgcatgatggtgcgcctcgtcaagggcgcctattgggacaccgagttgaag
cgcgcccaggagcgcggtctcgccgactatcccgtcttcacccgcaaggcgatgaccgac
ctgaattacgaagcctgcgccgcgcagttgctgcgcctgcggccgcgcatcatcccgcaa
ttcgcgacgcataacgcgctgacggtcgcgagcgtcgccgagatggcaggtgacgccgag
aattttgagttccagcgcctgcacggcatgggcgaggcgctttatgagaagctgctggcg
gacaaggcgggctatgcctgccgcacctacgccccggtcggcggccatcaggatctgctc
gcttatctcgtgcgccgcctgctcgagaacggcgccaactcctccttcgtcagcgtctcc
ggcgaccctgacgtgcctgtcgcgcaattgctggtgccgcccgccgacctgatcggcaat
gcgggcgccgcccggcatcgccgcatcccattgccggccgacctctacggcccgtcgcgg
aagaactcggccggcgtggagctcggccatgccgagagcctggacgccctgctcgccgag
atcgcggcagccaccgccaagcccttcccggacgccagcccgatcatcgacggcaaggct
gtgggcggtacaccccgcccggttctctcccccattgacggcaaggcaatcggcaccgtc
gcggaagccgacgccgccttggccggccgcgccatgctcgccgccaaggccggcttcgat
gactggaaccgcacgcccgcccgcacacgcgccgcagctttgcgcaaggccgccgacctg
atggaggcaaagcgcggcctgctgctcgccttgctccaggccgaggccggcaagacgctg
gacgacgccatctccgaggttcgcgaggcggtcgatttctgccgctattatgccgccgag
gccgaggccaaattcgccatgccgaccgccctccccggcccgaccggcgaggagaaccgc
ctgatcctgcgcgggcgcggcccgttcctgtgcatcgcgccgtggaacttcccgctcgcc
atcttcgccgggcaagtcgccgccgcgctcgtcgccggcaacagcgtcgtcgccaagccc
gccccgcagacacccctgatcgccactgtgaccgtgcgcctgctgcacgaggccggcgtg
cctgtttcggctttgcacctgacccctggcgacggcgcgctcggcgcggcgctggtcgcg
catcccgcggtggccggtgtcgccttcaccggctcgaccgccaccgcccgcgccatcaac
cgcgcgcttgccgccaaggacgggccgatcgtcccgctcatcgccgagaccggtgggctc
aacgccatgatcgtcgatgcgacggcactggccgagcaggttgccgacgacgtcgtgatg
tcggccttccgttctgccggccagcgctgctcggccctgcgcctgctcgtggtgcaggag
gacgtcgccgacaagatggtcgagatgatcaccggcgccggcggcgaattgaagctcggc
gatccgcgccggatcgagacccatatcggcccggtcatcgacgccgctgccaagcagcgg
ctcgatagccatgtcgaggcgatgcgcaagctcggccgcatcgtctgggccggcgacgcg
cccgcgctgggcggcactttcgtcgccccccatgtcgtcgcgctgaacagcatcgcggag
ctcgatcgcgagcatttcggcccaatcctgcatgtcgtgcgctggaaatcgggtcagctc
gacaaggtcatcgaagcgatcgaggcgaccggctacggcctgacgctgggcgtgcattca
cgcatcgaaaccaccgtcgaggaggtcgtcagccgcctctcgaccggcaacatctacgtc
aaccgcaacatcatcggcgcggtcgtcggcgcgcaacccttcggcggtcatggcctctcg
ggcaccggccccaaggccggcgggccgaactacctgatgcgctttgccaccgagcagacc
gtgacggtgaacacggccgccgccggcggcaatgccagcctgatcgccatgggggagtga

DBGET integrated database retrieval system