KEGG   Bacillus wiedmannii: CT694_03790Help
Entry
CT694_03790       CDS       T05831                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CT694_03790
Enzymes [BR:bwd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CT694_03790
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CT694_03790
    1.1.1.-  
     CT694_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: AZJ18885
UniProt: A0A3Q8R311
Position
716962..718014
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVRPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGDGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgcgatgtacgagtagaagaagtaccagaacca
actgtaagaccaggagcagttaagattaaagtgaaatggtgtggtatctgcggaacagac
ttgcatgaatatttagcaggacctatttttattccaacagaagagcacccattaacacac
gtaaaagcaccggttattttaggtcatgagtttagtggtgaggtagttgaaatcggtgaa
ggcgttacttctcataaagtgggagatcgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagacggcggcggtttctctgaatatacagtagtaccagaagatatggtccac
catattcctgatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagcggtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgtcattcaagcagctaaagcagcaggagcaactcctgttatt
gcagtagaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggactatgta
ttaaatccagctactcaagatgtactagcagaaattcgtaacttaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgtcgaagtagtacttcgtcaagcgattgaaagt
acaagctttgaaggacaaactgtaattgttagtgtgtgggaaaaagatgcgacaattacg
ccaaacaaccttgtactaaaagaaaaagaagttatcggtattcttggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaatcacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system