KEGG   Bacillus wiedmannii: CT694_06955Help
Entry
CT694_06955       CDS       T05831                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bwd  Bacillus wiedmannii
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bwd03009]
    CT694_06955
Enzymes [BR:bwd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CT694_06955
Ribosome biogenesis [BR:bwd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CT694_06955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AZJ19448
Position
1286783..1287706
Genome map
AA seq 307 aa AA seqDB search
METKKKGEWCEITVPAKWNGISIDSLLKIEWEIPKKLLHQLRMEKGITVNGEQRRWNELL
KEGDKLQVHMFMEEEYDVDPEYGELDVVYEDDHVLIVNKPEKMDTHPAEKGGMGTLANLV
AFHFQMQGLETKVRHIHRLDKDTTGGVVFAKHRIAGAIMDRLLMERKIKRTYAALVEGKV
KGKQGTIDAAIGRDRHHATRRRVSPKGDQAITFYKVEKYFKNQNVTFVTLQLETGRTHQI
RVHMSYHGNPLVGDVLYGGQTQYMSRQALHAMKINFLHPITKEEIEVDVPFPAKLNDTMK
EFQRMNA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaagaagaagggcgaatggtgcgaaattactgttccagcgaaatggaatggc
ataagtattgattcgttattaaaaatagaatgggaaataccgaaaaagttgttacatcag
cttcgtatggaaaaaggtattaccgttaacggagaacagagaagatggaatgagctttta
aaagaaggcgataagttacaagtgcatatgtttatggaagaagaatacgatgtagatcct
gaatatggtgaattagatgtagtatatgaagacgatcacgtactcatcgtaaataagcct
gagaagatggatacgcatcctgcggaaaaaggtgggatgggaacacttgcaaaccttgtt
gcttttcattttcaaatgcaaggtttagagacgaaggttcgtcatattcatcggttagat
aaagatacgacaggtggtgtcgtgtttgctaagcatagaattgctggtgcaattatggat
cgtttattaatggaacgaaaaattaaaagaacatatgcggcgcttgtggaagggaaagta
aaaggtaagcaaggaacaattgacgcagctattggaagagatcgccatcatgcgacgaga
cgacgtgtttctccaaagggagatcaagctatcacattttataaagtagagaagtatttt
aaaaaccaaaatgttacgttcgtaacgttacaattagaaacaggtagaacccatcaaatt
cgtgttcatatgagctatcatggtaatccattagttggggatgtattatatggtggacaa
acgcaatatatgtccaggcaagcattacatgcgatgaagataaacttcttacatccaatt
acgaaagaagagatcgaagtggatgtaccattccctgcaaaattaaatgatacaatgaaa
gaatttcaaagaatgaatgcgtaa

DBGET integrated database retrieval system