KEGG   Bacillus wiedmannii: CT694_11530Help
Entry
CT694_11530       CDS       T05831                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00860  Porphyrin and chlorophyll metabolism
bwd01100  Metabolic pathways
bwd01110  Biosynthesis of secondary metabolites
bwd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CT694_11530
Enzymes [BR:bwd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CT694_11530
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CT694_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 TrkA_N Sirohm_synth_M Pyr_redox 2-Hacid_dh_C XdhC_C Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AZJ20288
UniProt: A0A3Q8R7W6
Position
complement(2150585..2151055)
Genome map
AA seq 156 aa AA seqDB search
MYNMYPLMLNLNKKVVVIVGGGKIAYRKASGLKDTGAFVTIISPEICEEMKELPYITWKQ
KTFSNDDIKDAHLIYAATNQHAVNMMVKQAAHDFQWVNVVSDGTKSSFHTPGVIRHDEYV
VTISTSGKNPSYTKRLKQALTSIFPKLIKKLSRTHK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtataacatgtaccctcttatgcttaatctaaataaaaaagtagttgttatagttggt
ggaggtaaaattgcatatcgaaaagcgtctggattaaaagatacaggcgcttttgtcacc
attatcagcccagaaatttgcgaggaaatgaaggaactaccttatattacttggaagcaa
aaaacttttagtaatgatgatattaaagatgctcatcttatttatgcagctacaaatcaa
catgctgtaaatatgatggtcaaacaggccgcccatgatttccagtgggttaatgttgta
agtgatggtacaaaatcatcgtttcacacacctggtgtcatccgacatgatgaatatgtt
gtcactatttcaacttcaggtaaaaatccatcatatacaaagcgtttgaagcaggcacta
acatctatatttcctaaacttataaaaaagctttctcgtactcacaaataa

DBGET integrated database retrieval system