KEGG   Bacillus wiedmannii: CT694_14700Help
Entry
CT694_14700       CDS       T05831                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00380  Tryptophan metabolism
bwd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CT694_14700 (kynA)
Enzymes [BR:bwd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     CT694_14700 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AZJ20853
UniProt: A0A3S8Q9L1
Position
complement(2799794..2800633)
Genome map
AA seq 279 aa AA seqDB search
MKENEKVIMEKGIHTDFKENMTYGEYLQLDSLLSSQKRLSDHHDEMLFIVIHQASELWMK
LILHELNAAIESIKQDKLQPAFKMLARVSKIQSQIIQSWDILATLTPSEYIEFRDSLGQA
SGFQSYQYRMIEYALGYKTPHALKIYEKDPELHARLHTALHAPSLYDVAIQALVKEGFPI
HKDVLNRDITQPYEEDATVEAAWIEVYADVKKYWNLYQLAEKLIDIEDWLQQWRFRHMKT
VERIIGHKMGTGGSSGVSYLKRVLDQCFFPELWNVRTKL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaacgaaaaggtaattatggaaaaaggaattcatacggattttaaagagaat
atgacgtacggggagtatttacaattagatagtttactatcttctcaaaagagattatca
gatcatcatgatgaaatgttattcatcgtgattcaccaagcaagtgaactttggatgaag
cttattttacatgagttaaacgcagcgattgaatctattaaacaagataaattacaacca
gcttttaaaatgttagcacgtgtatcaaaaattcagtcgcaaattattcaatcttgggat
attcttgcgacattaacaccatcagagtacattgagtttcgtgactcactcggtcaagct
tcaggttttcaatcgtatcaatatcgtatgattgagtatgcgcttggctataaaacgccg
cacgcattaaaaatttatgaaaaagatccagaattacacgctcgacttcatacagcgcta
cacgcaccaagtttgtatgatgtggcaattcaagcacttgtaaaagaaggattccctatt
cataaagatgtgttaaatcgtgatattacgcagccttatgaagaagacgcaacagtagaa
gcagcatggatagaagtgtatgccgatgtgaaaaaatattggaacttatatcagcttgct
gaaaaattaattgatatcgaagattggctacaacaatggcgtttccgtcatatgaaaacg
gtagaacgtattattggtcataaaatgggaacaggcggatcttctggtgtatcgtattta
aaacgagtacttgatcaatgtttcttcccagagctttggaatgttcgtacgaaattataa

DBGET integrated database retrieval system