KEGG   Bacillus wiedmannii: CT694_15975Help
Entry
CT694_15975       CDS       T05831                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bwd  Bacillus wiedmannii
Pathway
bwd00330  Arginine and proline metabolism
bwd01100  Metabolic pathways
bwd01110  Biosynthesis of secondary metabolites
bwd01130  Biosynthesis of antibiotics
bwd01230  Biosynthesis of amino acids
Module
bwd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bwd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CT694_15975
Enzymes [BR:bwd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CT694_15975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 PDH IlvN MTD NAD_Gly3P_dh_N SIS_2 2-Hacid_dh_C ApbA GFO_IDH_MocA UDPG_MGDP_dh_C Shikimate_DH 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AZJ21084
UniProt: A0A3Q8R900
Position
3026882..3027700
Genome map
AA seq 272 aa AA seqDB search
MDKQIGFIGCGNMGMAMIGGMLHKKIVSANNIICSDLNTKNLKHANEKYGLTTTTDNNEV
AKNADILILSIKPDLYASVINEIKEVIKNDVIVVTIAAGKSIKSTEESFEKKLKVIRVMP
NTPALVGEGMSALCPNEMVTEKDLEDVLNIFNSFGQSEIVSEKLMDVVTSVSGSSPAYVY
MIIEAMADAAVLDGMPRNQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTTIEAV
ATLEEKGLRTAIISAMQRCTQKSVELSGQTKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaaattggattcatcggttgcggaaatatgggaatggctatgattggtggg
atgctacacaaaaagatagtgtctgcaaataatattatttgttcggatttaaacactaag
aatttaaaacatgctaatgaaaaatatgggctaactacaactactgacaacaatgaagtt
gctaaaaatgctgatattttaattttatcaattaaaccagacttatacgcatcagtaatt
aacgaaataaaagaagtgatcaaaaacgatgttatcgtcgtaacgatcgctgctggaaaa
agcatcaaaagtacagaggaatcttttgagaagaaattaaaagttatacgagtaatgcct
aatacccctgctcttgttggagaaggaatgtctgcgttatgcccaaatgaaatggtaaca
gaaaaagatttagaagatgtactaaacattttcaatagctttggtcaatcagagattgta
agcgaaaaattaatggacgttgttacatctgtaagcggttcttcaccagcatacgtatat
atgattattgaagcgatggcagatgcagctgtattagatggtatgccacgaaatcaagca
tataaattcgctgctcaagctgtgttaggctctgcaaaaatggtactagaaacaggaata
catccaggtgaattgaaagatatggtttgttctcctggtggaacaacgatagaagctgta
gcaacattagaggaaaaaggattacgaactgcaattatttcagcaatgcagcgctgtaca
caaaagtctgttgaactatctggtcaaacgaaaaagtaa

DBGET integrated database retrieval system